TFome Information for pUT5388

TFome Name pUT5388
Genbank Insert ID KJ727528
Protein Name ZmMYB103
Species Maize
TF Family MYB
Gene ID GRMZM2G111045
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B278_F 3' Primer Name: B278_R
5' Primer Tm (º C): 69.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGAAGGGCACCCTGCTGCG 3' Primer Sequence: CTTGAAAGCCGAGTCCAGGGACG
PCR Condition: PCR Reaction Mix: 8.75l ultrapure water 2.5l 10x t
Nucleotide Sequence: ATGGGAAGGGCACCCTGCTGCGACAAGAACAAGGGCCTCAAGAAGGGGCCCTGGACGCCGGAGGAGGACAAGCTCCTCGTCGACTACATCCAGACCAACGGCCATGGCAGCTGGCGCCTGCTCCCCAAGCTCGCAGGGCTGAACCGGTGCGGCAAGAGCTGCCGACTGCGGTGGACCAACTACCTCCGGCCGGACATCAAGCGCGGGCCCTTCACAGCCGAGGAGGAGAAGTCCATCGTCCAGCTCCACGCCATCGTCGGCAACAAGTGGTCCATGATCGCGGCGCAGCTCCCAGGCCGGACGGACAACGAGATCAAGAACTACTGGAACACGCACCTCAAGAAGCAGCTGCGCCGGATGGGCCTCGACGAGCCCCCGCCCGGCCCGGCCGCCGGCTGCCCCGCCGCGCGCCACATGGCGCAGTGGGAGACGGCCAGGCTCGAGGCCGAGGCGCGCCTCTCCCTCCTCGCCGCCACCGCCGCCTCCTCCGGCACCACCGCGACCACCACAGCCACCACCACCACGTCTGCAGCCTCCTCGTCCTCCACCACCGTCGCTGGCGCGGCCGACAACAAGGCCTCCAACCCCGCGGACATCTTCCTGCGCCTGTGGAGCTCGGACATCGGGGACTCCTTCCGCCGCAAGACGGACACGACGCCAGCGGTGCCCGCGCTTCCGGCGCCCGTCGTCAAGAGGAAGGACACGGCGATCAAGCAGGAGCCGCGGGCGCTGCTGCTCGGCCTCAGGGACGACTCCTCGGCGGCGTCCAACGACAACGAGACGGAGGTGGCGGAGGCGCTGGAGGCGAAGTACCAGATGTTCCTCGACTTCGCGGGCGAAGAGCTGGGATTGTTCCATGGCCGGCACGGCGGCTTCTCGCTGTTCCCGCCGCTCGACGTGCTCGCTGAGGCGTCCCTGGACTCGGCTTTCAAG
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCDKNKGLKKGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAGLNRCGKSCRLRWTNYLRPDIKRGPFTAEEEKSIVQLHAIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMGLDEPPPGPAAGCPAARHMAQWETARLEAEARLSLLAATAASSGTTATTTATTTTSAASSSSTTVAGAADNKASNPADIFLRLWSSDIGDSFRRKTDTTPAVPALPAPVVKRKDTAIKQEPRALLLGLRDDSSAASNDNETEVAEALEAKYQMFLDFAGEELGLFHGRHGGFSLFPPLDVLAEASLDSAFK