TFome Information for pUT5389

TFome Name pUT5389
Genbank Insert ID KJ727529
Protein Name ZmMYB34
Species Maize
TF Family MYB
Gene ID GRMZM2G125522
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B280_F 3' Primer Name: B280_R
5' Primer Tm (º C): 63.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGGCGGAGGCGTG 3' Primer Sequence: CAACTGTCCGCAGTGCATCAGG
PCR Condition: PCR Reaction Mix: 5 l GC buffer 1 l primer forward
Nucleotide Sequence: ATGATGGCGGAGGCGTGGACGCCGGTGCCGTTCCCGCCGACGGCGCCCTGCTTCTGGCTGCACGACACGCACTCGGTTTTCTGGCGGGGAGGAGACGCGTGGACGGCGGCGGAGAACAAACTGTTCGAGAAGGCGCTGGCGCAGATCGACCGTAACGCGCCCGACAGGTGGGAGAAGGTGGCGGAGGTGGTGCGCACGAAGACGGTCGACGACGTGAGGAACCACTACCACGACCTGGAGAACGACGTCGGCTTCATCGAGGCCGGGCTCGTGCCGTTCCCGCACTACAGCGGCTCGGTTCCGTCGTTCGGGTTCACCCACGAGGATTGGGACGGAGGGTTCAGGCGCGGCTACTGCCTTAAGCGCGCGCGCGGCTCCGACCCGGAGCGGAAGAAGGGCGTCCCCTGGACGGAGGAGGAGCACAAGCTTTTCTTGATGGGACTGAAGAAGTACGGGAGAGGGGACTGGAGGAACATCTCGCGCAAGTACGTGACGACCCGGACGCCGACGCAGGTGGCCAGCCACGCGCAGAAGTACTTCATCCGCCTCAACTCCGGCGGCAAGGACAAGCGCCGGTCCAGCATCCACGACATCACCACCGTCAACCTCCCCGACGAAGACCGCGGCAACGCGCCGCCGTCCGCGGTCACCACCACCACCAACCCCTCCGTCGCCCTCGTGGACATGAAGCCCTTCGTTGCGCCGTCGCTCGGCGTGCCGCACCCCTACGGCGACGTGAAGCTGGAGCCTAAGAGCTCGCTGGTGGCCGGCCTGGGCTTCAACGACTCCGTCCTCCTGATGCACTGCGGACAGTTG
TFome clones do not contain stop codon at 3'end.
translation: MMAEAWTPVPFPPTAPCFWLHDTHSVFWRGGDAWTAAENKLFEKALAQIDRNAPDRWEKVAEVVRTKTVDDVRNHYHDLENDVGFIEAGLVPFPHYSGSVPSFGFTHEDWDGGFRRGYCLKRARGSDPERKKGVPWTEEEHKLFLMGLKKYGRGDWRNISRKYVTTRTPTQVASHAQKYFIRLNSGGKDKRRSSIHDITTVNLPDEDRGNAPPSAVTTTTNPSVALVDMKPFVAPSLGVPHPYGDVKLEPKSSLVAGLGFNDSVLLMHCGQL