TFome Information for pUT5390

TFome Name pUT5390
Template DR807137
Genbank Insert ID KJ727530
Protein Name ZmMYB11
Species Maize
TF Family MYB
Gene ID GRMZM2G000818
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B283_F 3' Primer Name: B283_R
5' Primer Tm (º C): 67.9 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGTCGCCGTGCT 3' Primer Sequence: TTTCATCTCGAGTCTTCTG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGAGGTCGCCGTGCTGCGAGAAGGCGCACACGAACAAGGGCGCGTGGACCAAGGAGGAGGACGACCGTCTGGTGGCGTACATCAAGGCGCACGGCGAGGGGTGCTGGCGCTCCCTTCCCAAGGCCGCCGGACTTGTGCGCTGCGGCAAGAGCTGCCGCCTCCGGTGGATCAACTACCTGCGGCCCGACCTCAAGCGCGGCAACTTCACGGAGGAGGAGGACGAGCTCATCATCAAGCTCCACAGCCTACTCGGCAACAAATGGTCCCTGATCGCTGGAAGGCTGCCGGGCAGGACCGACAACGAGATCAAGAACTACTGGAACACGCACATCCGGCGGAAGCTGCTGAGCAGGGGGATCGACCCGGTGACACACCGCCCCATCAACGAGCACACGTCCAACATAACCATATCGTTCGAGGACTGGGGCCAGGGGAAGGCGCTCAAGTGCCCCGACCTGAACCTGGACCTCTGCATCAGCCCGCCGTGCCAGGAGGAGGAGGAGGCCATGCTGCTGAGGCCGGTGAAGCGGGAGGAGGCCGGGCTCTGCTTCAGCTGCAGCCTGGGGCTCCCCAAGAGCGCGGACTGCAAGTGCAGCAACTTCCTCGGGCTCAGGACCGCCATGCTCGACTTCAGAAGACTCGAGATGAAA
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRGIDPVTHRPINEHTSNITISFEDWGQGKALKCPDLNLDLCISPPCQEEEEAMLLRPVKREEAGLCFSCSLGLPKSADCKCSNFLGLRTAMLDFRRLEMK