TFome Information for pUT5391

TFome Name pUT5391
Genbank Insert ID KJ727531
Protein Name ZmMYB112
Species Maize
TF Family MYB
Gene ID GRMZM5G803308
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B291_F 3' Primer Name: B291_R
5' Primer Tm (º C): 66.6 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGCTCGGAGGCGGA 3' Primer Sequence: CTGCATCCGGCCGACCCG
PCR Condition: PCR Reaction Mix: 8.75l ultrapure water 2.5l 10x t
Nucleotide Sequence: ATGGGCTCGGAGGCGGACTGCGACAGGATCAGGGGCCCGTGGAGCCCCGAGGAGGACGACGCGCTGCGGCGGCTCGTGGAGCGGCACGGCGCGCGCAACTGGACGGCGATCGGGCGCGAGATCCCGGGGCGGTCGGGCAAGTCGTGCCGCCTGCGGTGGTGCAACCAGCTGTCGCCGCAGGTGGAGCGCCGGCCCTTCACGGCGGAGGAGGACGCGGCCATCGTCCGCGCCCACGCCCGCCTCGGCAACCGCTGGGCCGCCATCGCGCGCCTCCTCCCCGGCCGCACCGACAACGCCGTCAAGAACCACTGGAACTGCTCGCTCAAGCGCAAGCTCGCCGCCGCGTCCGCCCCGGCGGGTTCCTCCGACGTCGAGGCGCGCCCGACCAAGCGCGTCAGCCTCTCGCCCGACAGCCCGTCGGGGTCGGGGTCGGGGTCAGGGTCAGGGTCCGGGTCCGGGTCCGGGTCCGACCGTAGCGACCTGAGCCACGGCGCCGGCCAGGTTTACCGCCCAGTGGCGCGGTCCGGCGGGTTCGAGCCGGCGGACTGCGCGATGAGCCGTCCGCTGGAGGAAGAGGAGGAGGAAAAGGAGGACCCGCTCACCTCCCTCAGCCTCTCGCTTCCAGGCACGGACCAGCGGTTCCACCACGACCGCGCCCACAGCCAGTTCCAGGAGCTCCCGGCGTCGCCGCCCTCGCCCTCCCCGCCTCCGCCGCCGGTTCTCTCGGCGTACCCGTTCAGCCCCGTGTTCATGGAGGCGATGCAGGAGCTGATCCGCACGGAGGTGCAGCGGTACATGGCGAGCGTGGGCGTGCGCGCCGGGTGCGGCGCCGCCGGCGGGGCCGACCTCTGCATGCCGCAACTGGTCGACGGCGTCATGCGCGCCGCCGCCGAGCGGGTCGGCCGGATGCAG
TFome clones do not contain stop codon at 3'end.
translation: MGSEADCDRIRGPWSPEEDDALRRLVERHGARNWTAIGREIPGRSGKSCRLRWCNQLSPQVERRPFTAEEDAAIVRAHARLGNRWAAIARLLPGRTDNAVKNHWNCSLKRKLAAASAPAGSSDVEARPTKRVSLSPDSPSGSGSGSGSGSGSGSGSDRSDLSHGAGQVYRPVARSGGFEPADCAMSRPLEEEEEEKEDPLTSLSLSLPGTDQRFHHDRAHSQFQELPASPPSPSPPPPPVLSAYPFSPVFMEAMQELIRTEVQRYMASVGVRAGCGAAGGADLCMPQLVDGVMRAAAERVGRMQ