TFome Information for pUT5392

TFome Name pUT5392
Genbank Insert ID KJ727532
Protein Name ZmMYB129
Species Maize
TF Family MYB
Gene ID GRMZM2G070523
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B309_F 3' Primer Name: B309_R
5' Primer Tm (º C): 69.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGGAGAAGAGCCCGGGCGCC 3' Primer Sequence: CTCACCTCCGCCACCATGCCACTCCA
PCR Condition: PCR Reaction Mix:5 l GC buffer (NEB) 0,5 l primer
Nucleotide Sequence: ATGGAGAAGAGCCCGGGCGCCGCGCCGACATCATCGCCCGAGGAGGAGGTGGCGGCGGATGGCCGCGGGCACGTTGAGGACGCGACGGGGCAGAAGGAGCAGGCGACGCCGGTGGTGCTCAAGAAGGGGCCGTGGACGGCAGCGGAGGATGCCATGCTCATGGACCACGTCCGGCACCACGGCGAGGGGAACTGGAACGCAGTGCAGAGGGTGACCGGCCTGCTGCGCTGCGGCAAGAGCTGCCGCCTGCGCTGGACCAACCACCTCCGCCCCAACCTCAAGAAGGGCTCCTTCTCCCCCGACGAGGAGCTCCTCATCGCCCAGCTCCACGCGCAGCTCGGCAACAAGTGGGCGCGCATGGCCGCGCATCTGCCGGGGAGGACGGACAACGAGATCAAGAACTACTGGAACACGAGGACCAAGCGCCGCCAGCGCGCCGGCCTGCCTGTGCACCCGCCGCCAGAGGTGCAGCTCCAGCTCGCCCTCGCCAGGCGCTGCCGCTACGACGACTTCTCGCCGCTGCCGTCCCCGCAGGAGCTGTCCGGTGTCCAGGCGCTGGTGGGCGCCGCCGCCTCGGCCGGGTACGCCAGCTCCCGCCCGGCGCCCCTCGACCTGGCTCGGCAGCTCACCCAGACGACGAACCAGCAGACGGAGACTGTGCAGTTCCTCTCGCCGCCACCCTTCTCGGCGCCGTCGTCCCCGTGGGCGAGGCCGTTCGCCCGGAACGCGCAGTACTTCCAGCTCGCGCACTCGTCGTCGCCCGTGTCCCCGACGACGCCGGACCTGTCCCTCGGCTACGGCGCGCGCAGCGCCGGCGCCGACCAGAGCAGGCTCCCGCCGCTCTCGCCGTCCCCTTGCCCCAGAGTGGTGGAGCTCCCTTCAAACCAATACGCCCAACCGACGCCGCCGGCCTCGGCCGCCGCCACCGCACTTGGAGGTGGTGGCGCAGCGCTGCCGGATCATCAGAACGCGGCGAGCCTCGAGAAGATGCTGCGCGAGCTGCATGACGTCATCAAGGTCGACCCGCCGGCGCTGGTCCCGGCCAGCGGCGGCGCTGCCCTGGAGTGGCATGGTGGCGGAGGTGAG
TFome clones do not contain stop codon at 3'end.
translation: MEKSPGAAPTSSPEEEVAADGRGHVEDATGQKEQATPVVLKKGPWTAAEDAMLMDHVRHHGEGNWNAVQRVTGLLRCGKSCRLRWTNHLRPNLKKGSFSPDEELLIAQLHAQLGNKWARMAAHLPGRTDNEIKNYWNTRTKRRQRAGLPVHPPPEVQLQLALARRCRYDDFSPLPSPQELSGVQALVGAAASAGYASSRPAPLDLARQLTQTTNQQTETVQFLSPPPFSAPSSPWARPFARNAQYFQLAHSSSPVSPTTPDLSLGYGARSAGADQSRLPPLSPSPCPRVVELPSNQYAQPTPPASAAATALGGGGAALPDHQNAASLEKMLRELHDVIKVDPPALVPASGGAALEWHGGGGE