TFome Information for pUT5431

TFome Name pUT5431
Genbank Insert ID KJ727571
Protein Name ZmHB110
Species Maize
TF Family Homeobox
Gene ID GRMZM2G061101
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B753_F 3' Primer Name: B753_R
5' Primer Tm (º C): 60.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGGAGATCTACTGTCACATGTTGGTA 3' Primer Sequence: CGGGCCACGGGGATACGA
PCR Condition: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58&de
Nucleotide Sequence: ATGGAGATCTACTGTCACATGTTGGTAAGGTACAGACAGGAGCTCACAAGGCCAATCCAGGAAGCGGACGAATTCTTCAAAAGCATGGAGGCCCAGATCGACTCATTTTCATTAGATGACAATGGCTATGAAGAAGGAGGCGGTTCCTCCGACGAAGATGAGCAAGAAACCGTCGACTTGGGCGGCCTTCCGGTCCCTGAGACCGGCAGCCCGTCCGGAGAGGGCAAGGAGCTGAAGAACCACCTCCTGAACAAGTACAGCGGCTACCTGAGCAGCCTCTGGAGGGAGCTCTCGAGGAAGAAGAAGAAAGGCAAGCTGCCGAGGGACGCCCGCCAGAAGCTCCTCCACTGGTGGCAGCTGCACTACAGATGGCCCTATCCCTCGGAGCTGGAGAAGGCGGCGCTGGCGGAGTCGACGGGGCTCGACGCGAAGCAGATCAACAACTGGTTCATCAACCAGCGGAAGCGCCACTGGAAGCCGGCGCCGCCGACGATGGCGCTAGGCACACCAGATTACAGGATGGGCCAGCACGGCGGCGGTGCTTCTAGCAGCTCGGCCTCCGCTGGTCTCCGCGTGCAGGGGCAGTACTTCACCGGCGGAAGCTCGTATCCCCGTGGCCCG
TFome clones do not contain stop codon at 3'end.
translation: MEIYCHMLVRYRQELTRPIQEADEFFKSMEAQIDSFSLDDNGYEEGGGSSDEDEQETVDLGGLPVPETGSPSGEGKELKNHLLNKYSGYLSSLWRELSRKKKKGKLPRDARQKLLHWWQLHYRWPYPSELEKAALAESTGLDAKQINNWFINQRKRHWKPAPPTMALGTPDYRMGQHGGGASSSSASAGLRVQGQYFTGGSSYPRGP