TFome Information for pUT5432

TFome Name pUT5432
Genbank Insert ID KJ727572
Protein Name ZmMADS67
Species Maize
TF Family MADS
Gene ID GRMZM2G147716
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B755_F 3' Primer Name: B755_R
5' Primer Tm (º C): 72.3 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGCGGGGGCCGGT 3' Primer Sequence: CTTGACAGTGCGGAGCATCCATGGTGGC
PCR Condition: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58&de
Nucleotide Sequence: ATGGGGCGGGGGCCGGTGCAGCTGCGCCGGATCGAGAACAAGATCAACCGCCAGGTGACCTTCTCCAAGCGCCGGAACGGGCTGCTGAAGAAGGCCCACGAGATCTCCGTGCTCTGCGACGCAGAGGTCGCGCTCATCGTCTTCTCCACTAAGGGGAAGCTCTACGAGTACTCTAGCCATTCCAGCATGGAAGGCATTCTTGAGCGTTACCAGCGTTACTCATTTGAAGAAAGGGCAGTACTTAACCCAAGTATTGAAGACCAGGCAAATTGGGGAGATGAATATGTCCGGTTAAAATCCAAACTTGATGCACTTCAGAAGAGTCAAAGGCAGCTGTTAGGAGAACAATTGAGTTCACTGACCATAAAAGAACTCCAGCAACTGGAGCAACAACTGGACAGTTCTTTGAAGCATATTAGGTCAAGAAAGAATCAGCTCATGTTCGATTCAATTTCCGCGCTTCAGAAAAAGGAGAAAGCACTTACAGATCAAAACGGTGTCCTGCAAAAGTTCATGGAGGCAGAGAAGGAGAAAAACAAGGCTTTGATGAACGCGCAGCTCCGGGAGCAGCAAAATGGAGCATCAACAAGCTCCCCATCACTTTCACCACCAATAGTTCCAGATTCCATGCCAACTCTAAATATAGGGCCATGTCAACATAGAGGGGCAGCAGAATCTGAGTCTGAACCGTCTCCTGCTCCTGCACAAGCAAACAGGGGCAACCTGCCACCATGGATGCTCCGCACTGTCAAG
TFome clones do not contain stop codon at 3'end.
translation: MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSSHSSMEGILERYQRYSFEERAVLNPSIEDQANWGDEYVRLKSKLDALQKSQRQLLGEQLSSLTIKELQQLEQQLDSSLKHIRSRKNQLMFDSISALQKKEKALTDQNGVLQKFMEAEKEKNKALMNAQLREQQNGASTSSPSLSPPIVPDSMPTLNIGPCQHRGAAESESEPSPAPAQANRGNLPPWMLRTVK