TFome Information for pUT5437

TFome NamepUT5437
Genbank Insert IDKJ727577
Protein NameZmHB34
Species Maize
TF Family Homeobox
Gene ID GRMZM2G002915
transcript T01
VectorpENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B797_F 3' Primer Name: B797_R
5' Primer Tm (º C): 64.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGACCCCGCTAGTAGCCT 3' Primer Sequence: ATACTGCCGATCGTTCCATACCC
PCR Condition: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58&de
Nucleotide Sequence: ATGGACCCCGCTAGTAGCCTGATCAGCAGCTCCGCGGTACCATTCCCTGCTGCCGGCGATGGCGGCGGACAGCGACAGGTGTTTCTCTTTGGCGGCGGATTCGTTGGAGGAGCGCCGCCGTTGGTGGGTGGTGCGGCGGACGGGCGGCGCAAGCGGCCGTTCCAGCTGACGGCGCACGATGAGCTGCAGCTGCAGCTGCAGCTCCAGCTGGACGACGAGCTGTGCGGCCTGGACTACGAGCTCCATGGGCCGCAGCAGGAGCGGACAACGAAGCGGCGGCTGACGGCGGAGCAGGTGCGGGAGCTGGAGCTGAGCTTCGAGGAGGAGAAGCGGAAGCTGGAGCCCAAGCGGAAGCTGGAGCCCGAGCGGAAGAGCGAGCTGGCGCGGAGGCTCGGGATCGCGCCGCGCCAGGTGGCCGTGTGGTTCCAGAACCGCCGCGCGCGGTGGAGGAGCAAGCAGCTGGAGCAGGACTTCGACCGCCTCAGGGCCGCGCACGACGACCTCATCGCCGGCCGCGACGCGCTCCTCGCCGATAACGATCGTCTCCGCTCACAGGTGATCACGTTAACTGAGAAACTGCAAACGAAAGAGTCGGCGGCGGCGGCGGCAGAGCCTGGAGAGCAGACAGTTGCCGCCCAAGCGACAGCCTACGCTGTCTTGGAAGGAGACAAGCTCTGCTCCGGCAGCGCTGCAGCGCCGGCGGCGGCAGGGACCAACGACAGCCCGGAGTCGTACTTCGCCGGGGCGCGCTCGCCACCGTCGTCGCCAGAGGACGACGACCGCGCCTTCTTCTTCCCCCCGGACGCCCTGCTCAACAACTGGGCATGGGTATGGAACGATCGGCAGTAT
TFome clones do not contain stop codon at 3'end.
translation: MDPASSLISSSAVPFPAAGDGGGQRQVFLFGGGFVGGAPPLVGGAADGRRKRPFQLTAHDELQLQLQLQLDDELCGLDYELHGPQQERTTKRRLTAEQVRELELSFEEEKRKLEPKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWRSKQLEQDFDRLRAAHDDLIAGRDALLADNDRLRSQVITLTEKLQTKESAAAAAEPGEQTVAAQATAYAVLEGDKLCSGSAAAPAAAGTNDSPESYFAGARSPPSSPEDDDRAFFFPPDALLNNWAWVWNDRQY