TFome Information for pUT5438

TFome Name pUT5438
Genbank Insert ID KJ727578
Protein Name ZmMYB84
Species Maize
TF Family MYB
Gene ID GRMZM2G173633
transcript T01
Vector pENTR/SD/D-TOPO
Note c.C187T p.P63S In between two Myb-domains. Present in template FLcDNA.
Request Information: Deposited to ABRC
5' Primer Name: C142_F 3' Primer Name: C142_R
5' Primer Tm (º C): 67.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGCGGATCCCGTGC 3' Primer Sequence: CACCATGTGATTGGTCAGCTCGTCG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGCGGATCCCGTGCTGCGAGAAGGACAGCGTCAAGCGCGGGCAGTGGACGCCCGAGGAGGACAACAAGCTGCTCTCCTACATCACCCAGTACGGCACGCGCAACTGGCGCCTCATCCCCAAGAATGCCGGACTGCAGCGATGCGGGAAGAGCTGCCGGCTCCGGTGGACCAACTACCTGCGTTCCGACCTCAAGCACGGTGAGTTCACGGACACCGAGGAGCAGACCATCATCAAGCTGCACTCCGTCGTTGGCAACAGGTGGTCGGTGATCGCGGCGCAGCTGCCGGGTCGGACGGACAACGACGTCAAGAACCACTGGAACACCAAGCTGAAGAAGAAGCTGTCCGGGATGGGCATCGACCCCATCACGCACAAGTCCTTCTCGCACCTCATGGCCGAGATCGCCACCACGCTGGCGCCGCCGCAGGTGGCCCACCTCGCCGAGGCCGCGCTGGGGTGCTTCAAGGACGAGATGCTCCACCTCCTCACCAAGAAGCGCCCCACCGACTTCCCGTCGCCCGCGGTGCCCGACATGTCGGCGATCGCGGGCGGCTCCGGCGTCGCGGCGCCCTGCGGCTTCCCGGCGCCGCCCCAGACCGACGACACCATCGAGCGCATCAAGCTGGGCCTGTCCCGCGCCATCATGAGCGAGCCCGCCGCGCCCCCCGGCAAGCAGGAGCAGCCCTGGGCGCCGGCCGACTTGCCGGAGGGGCTGCCGGGGATGTACGCCACGTACAATCCCGCCTCGCACGGACACGAAGAGTTCCGCTACGACAACGGGACAGTGCCGGAGTACGTCCTCGGCGGCGGCGGCGGCGCGGACCAGGGCACGTCGATGTGGAGCCACCAGAGCATGTACAGCGGGAGTTCGGCCACGGAGGCCGCGCCCAGGCCGGCGGAGGTGTTGCCGGAGAAAGGCAACGACAGCGTCGGGAGCAGCGGCGGCGGCGAGGAGGCGGACGACGTCAAGGACGGCGGGAAAGGCGGCTCCGATATGTCCGGCCTGTTTGGATCCGACTGCGTACTTTGGGACTTGCCCGACGAGCTGACCAATCACATGGTG
TFome clones do not contain stop codon at 3'end.
translation: MGRIPCCEKDSVKRGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGLQRCGKSCRLRWTNYLRSDLKHGEFTDTEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPITHKSFSHLMAEIATTLAPPQVAHLAEAALGCFKDEMLHLLTKKRPTDFPSPAVPDMSAIAGGSGVAAPCGFPAPPQTDDTIERIKLGLSRAIMSEPAAPPGKQEQPWAPADLPEGLPGMYATYNPASHGHEEFRYDNGTVPEYVLGGGGGADQGTSMWSHQSMYSGSSATEAAPRPAEVLPEKGNDSVGSSGGGEEADDVKDGGKGGSDMSGLFGSDCVLWDLPDELTNHMV