TFome Information for pUT5469

TFome NamepUT5469
Genbank Insert IDKJ727609
Protein NameZmWRKY105
Species Maize
TF Family WRKY
Gene ID GRMZM2G102583
transcript T01
VectorpENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C408_F 3' Primer Name: C408_R
5' Primer Tm (º C): 60.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGACGACCCTCGATCTGATG 3' Primer Sequence: GCAGCAGAGAAACAAGCCACCA
PCR Condition: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58&de
Nucleotide Sequence: ATGACGACCCTCGATCTGATGGGAGGGTACGGGCGGGTGGACGAGCAGGTGGCCATCCAGGAGGCCGCCACGGCGGGGCTGCGCGGGATGGAGCGTCTCATCTTGCAGCTCTCCCAGGCTGGCACCGGGGAGCGGTCGTTGTCCCCACCGGCGGTACAGGCGCAGCGCCAGCAGCAGAAGCAGCTGGAGCAGATCCAGCAGCAGGTTGACTGCCGGGAGCTCACGGACATGACGGTGTCCAAGTTCAAGAAGGTGATCTCCATCCTGAACCGCACGGGGCACGCGCGGTTCCGGCGTGGCCCCGTGGCGGCGCGGTCGCAGTCGCAGTCGCAGGGACCTGCCTCCCCCGAGCCCGCGCAATCGGCGCCGGCTCCCGCCGCGAGGCCCCTGACGCTGGACTTCACCAAGTCGGTGTCCGGTTACAGCAGGGACTCCGGGTTCAGCGTGTCCGGCGCGAGCTCGTCGTTCCTGTCGTCGGTGACGACCGGGGACGGGAGCGTGTCGAACGGGCGCGCGGGAGGCTCGTCGTTCCTCATGTTCCCACCGGCGCCCGGCGCGGCCAGCTGCGCGAAGCCGCCGCCCGCCGGTGCGGCGCAGAAGCGCAAGTGCCACGACCACGCGCACTCGGAGAACGTCGCCGGCGGCAAGTACGGGGCTAACGGCGGGCGCTGCCACTGCTCGAAGCGCAGGTCTGTATCTCTTCTCTTGCCTTGGTGGTGCCTTGGTGGCTTGTTTCTCTGCTGC
TFome clones do not contain stop codon at 3'end.
translation: MTTLDLMGGYGRVDEQVAIQEAATAGLRGMERLILQLSQAGTGERSLSPPAVQAQRQQQKQLEQIQQQVDCRELTDMTVSKFKKVISILNRTGHARFRRGPVAARSQSQSQGPASPEPAQSAPAPAARPLTLDFTKSVSGYSRDSGFSVSGASSSFLSSVTTGDGSVSNGRAGGSSFLMFPPAPGAASCAKPPPAGAAQKRKCHDHAHSENVAGGKYGANGGRCHCSKRRSVSLLLPWWCLGGLFLCC