TFome Information for pUT5525

TFome Name pUT5525
Template BT067525.1
Genbank Insert ID KJ727614
Protein Name ZmMYB23
Species Maize
TF Family MYB
Gene ID GRMZM2G150841
transcript T01
Vector pENTR/SD/D-TOPO
Note c.G649A p.G217R Not present in template FLcDNA. Not present in functional domain.
Request Information: Deposited to ABRC
5' Primer Name: C147_F 3' Primer Name: C147_R
5' Primer Tm (º C): 65.1 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCGAGGCGGACGAG 3' Primer Sequence: ATTCAAGCACCAACTGCTGC
PCR Condition: PCR Reaction Mix:5 l GC buffer (NEB) 1 l primer fo
Nucleotide Sequence: ATGGCGAGGCGGACGAGCGGCCCCAAGAAGAAGCTGAGGAGGGGCCTCTGGTCGCCGGAGGAGGACGATAAGCTCGTCAACCACATTGCCAAGTATGGCCACGGCTGCTGGAGTTCCGTCCCCAAGCTAGCAGGTCTAGAGAGGTGTGGGAAGAGCTGCAGGCTGAGGTGGATCAACTACCTCAGGCCGGACCTCAAGAGGGGAGCGTTCTCGCAGGAAGAGGAGGACCTCATCATCCATCTCCATTCCATGATGGGCAACAAGTGGTCTCAGATTGCTTCGCAGCTGCCGGGGCGGACGGACAACGAGGTGAAGAACTTCTGGAACTCGTACGTCAAGAAGAAGCTCCGGCAGCGCGGGATCGACCCGGCCACGCACAAGCCGCTCCCGCTGGCCGCCGAGGGCATCAGCAGCCGCACGGCGGTGTTCAGCGACGCCGAGCTCATCCTGTCGTCGTCGGCGGCGGCGGCGGCGGCGGGGCGGCACATGCCGCCACCGCCAGTGGCGGCATCGGCGGCGGAGAGCTACGTGTACAGCTACAGCCACAGCAGTGGCGGCGCGAGCGACGGCTCTCTGCAGTCGCTGTCGGGGTACAACAGCAACAGCAAGCAAACAGCTGCGGATCACTTGGGTGCCGCAGCCGCAGCGAGGTACCTGCAGCAGGAGCAGGACCCAGCAGCAGCAGCAGCAGCAGCCGACGCGCTGCACTGCGGACCCTCCGGTGCCCCGGCGGTCGTTCTCCCGTCGGTGTCCAGCTCCAGCACGCTGAACTCGATGGCTGGCCTAAGCCCCGCGGCCACCACCACCGACGAACAGTGCACCAACAACTGTAGCAGCTGCAGCTTCCACAGCGGGTTGGAGCCGTGGCTGGAGCTGGGCAGCACGAGCGGCTACTACGGCGCGGCGCTGGACGAGCTCAAGTGGTCCGACTACGTGTTCGACGGCGGCTACGGTGGCCAGCCGGGACAGGGCATCTACGGCGACAGCAAGGACGCCGTGCAGTTCGTGGACGCCAACGCGCTCAGCAGCAGCAGTTGGTGCTTGAAT
TFome clones do not contain stop codon at 3'end.
translation: MARRTSGPKKKLRRGLWSPEEDDKLVNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYLRPDLKRGAFSQEEEDLIIHLHSMMGNKWSQIASQLPGRTDNEVKNFWNSYVKKKLRQRGIDPATHKPLPLAAEGISSRTAVFSDAELILSSSAAAAAAGRHMPPPPVAASAAESYVYSYSHSSGGASDGSLQSLSGYNSNSKQTAADHLGAAAAARYLQQEQDPAAAAAAADALHCGPSGAPAVVLPSVSSSSTLNSMAGLSPAATTTDEQCTNNCSSCSFHSGLEPWLELGSTSGYYGAALDELKWSDYVFDGGYGGQPGQGIYGDSKDAVQFVDANALSSSSWCLN