TFome Information for pUT5565

TFome Name pUT5565
Genbank Insert ID KJ727638
Protein Name ZmMYB100
Species Maize
TF Family MYB
Gene ID GRMZM2G143046
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B303_F 3' Primer Name: B303_R
5' Primer Tm (º C): 68.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCCACGACACAGA 3' Primer Sequence: TTGCATCTTCCAAATTTCCTCCA
PCR Condition: PCR Reaction Mix: Volumes per reaction (25l): 5 l
Nucleotide Sequence: ATGGCCACGACACAGAGCTGTCAGAGCAGGAGCAGCGCCTGCAGCAAGGCTGCTGCTTGCTTCCCGGCCGCCGTAGCGGTCGACGAGGAGCACGGCCACCACAGCCACCAGCTGAAGGGAGGAGCGCAGGAGGAGGCTGAGAACGACAATAATAAGCCGGAGCTCCGGCGTGGCCCCTGGACGGTAGACGAGGACCTCACCCTCGTCAACTACATCGCCGACAACGGCGAGGGTCGCTGGAACAACCTCGCCCGCGCCGCCGGGCTGAAGCGGACGGGCAAGAGCTGCCGGCTGCGGTGGCTCAACTACCTCCGGCCCGACGTGAAGCGTGGCAACTTCAGCGCCGACGAGCAGCTGCTCATCCTCGACCTCCACACCCGCTGGGGCAACCGATGGTCGAAGATAGCGCAGCACCTGCCGGGAAGGACGGACAACGAGATCAAGAACTACTGGAGGACCCGGGTGCAGAAGCACGCCAAGCAGCTCAACTGCGACGCCAACAGCAAGCGCTTCAAGGACGCCATGCGCTACCTCTGGATGCCGCACCTCGCCGACGACGTCGATACCATCGCTGCGGCCAACGACGACGACGAAGACCACCACCACCACCTACGCCTCCTCGTCCTGCACCACCACCAGGCCCAGCACCTGCAGCAAGCTGCTGCCGCGGCCGGCGGCGCTGCCAACGACCTTGCTGCGGGCGCCTACGACGTCCGCCAGCTGCACGCGCTGCCGTCGTCGGGCATGGCGGCGACGTCGTCGTCCGACTCGCTCGCGTCGGAGTCGTACGATGACGGAGGCCTGCTTTTCGCGAACTTGCGCGCCGGCGAGATGCTGATGGACGGCGGAGATTGGGCGGCGCAGCAGGAGGCCGACCAAGGGCTGTGGCCGCCGCCGCCGCCGCCGCCGTCTGATCTTGATCAGTCGGTGGTGCAGGCTGCTGGTGCCGGCGCTGGCCAGTTTCAGGACATGGAGCTCAGTGGTTGGGTGCAAGGCTTCTCCGAGAGCATTACAGATAACTTTTGGGCCTTGGAGGAAATTTGGAAGATGCAA
TFome clones do not contain stop codon at 3'end.
translation: MATTQSCQSRSSACSKAAACFPAAVAVDEEHGHHSHQLKGGAQEEAENDNNKPELRRGPWTVDEDLTLVNYIADNGEGRWNNLARAAGLKRTGKSCRLRWLNYLRPDVKRGNFSADEQLLILDLHTRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLNCDANSKRFKDAMRYLWMPHLADDVDTIAAANDDDEDHHHHLRLLVLHHHQAQHLQQAAAAAGGAANDLAAGAYDVRQLHALPSSGMAATSSSDSLASESYDDGGLLFANLRAGEMLMDGGDWAAQQEADQGLWPPPPPPPSDLDQSVVQAAGAGAGQFQDMELSGWVQGFSESITDNFWALEEIWKMQ