TFome Information for pUT5593

TFome Name pUT5593
Template Genomic DNA
Genbank Insert ID KJ727666
Protein Name ZmMYB90
Species Maize
TF Family MYB
Gene ID GRMZM2G047600
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: SE0029_F 3' Primer Name: SE0029_R
5' Primer Tm (º C): 63.2 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCCGTGCTGTGGAAG 3' Primer Sequence: GTAGAGCGGTTGCTCCCAGATGT
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98&d
Nucleotide Sequence: ATGGCCGTGCTGTGGAAGGGTTCGTCGTCTTCGCCCTGTGACTGGCCGGAGGCGACGGTGACCACCGTCAGCGACGCCGACGACGACGCGGCGGCGGCGGCGGAGCTGCGGCGGGGGCCGTGGACGGTGGAGGAGGACGCGGTCCTGGCGGGCCACGTGGCCGCGCACGGCGAGGGGCGGTGGAACGAGCTGGCGTGCGCCGCGGGGCTCAGGCGCACCGGCAAGAGCTGCCGCCTGCGCTGGCTCAACTACCTCCGCCCCGGCGTGCGCCGCGGGGGCTTCACCCCGCGGGAGCAGCTGCTCGTCCTCGACCTCCACTCCCGCTGGGGCAACCGCTGGTCCAGGATCGCCGCGCACCTGCCGGGCCGCACGGATAACGAGGTCAAGAACTACTGGCGCACGCGGGTGCAGAAGCACGCCAGGCAGCTGGGCTGCGCCGTCGGCAGCCGCCAGTTCAACGACGCCGTGAGGAACCTCTGGGTGCCGCGCCTGCTCGAGAGGATCCACGCCGACGACTCAGCAGCAGCAGCCGCCGCCGATGCCGATGCCGATGCCTCTCGCTGCTGCTACTCCGCGAGCCCATCGCACGATGAGCTGTCGTCGTCCCACCCGGCGCACCGAAACGCTGCGCCCATCACGGGCGACGACTGCGCGCGCGCACCGTCCCCGGACGTGTCCAGTGTCGTCACTGGGTCCTCGTGGTCACGGGAGGCGTCCCCCACGTCGCAGTTGTTCAAGTCGAGCAGTTCGACCGTGGAGGGATGCTCTACTTCTACCGAGACCGAGCAGTGCCAGAACGGATGCTCCTCGAGCGCGACGAGCGTTGACATGTTCGACGAGAGCTGGTCGGAGCTTCTTGCTCGCGCCATCCATGACGACGACGCGGAATTCGGATCGGGAGAAACCGGAGACAGCTGGTGGAGTTTGGAGGACATCTGGGAGCAACCGCTCTAC
TFome clones do not contain stop codon at 3'end.
translation: MAVLWKGSSSSPCDWPEATVTTVSDADDDAAAAAELRRGPWTVEEDAVLAGHVAAHGEGRWNELACAAGLRRTGKSCRLRWLNYLRPGVRRGGFTPREQLLVLDLHSRWGNRWSRIAAHLPGRTDNEVKNYWRTRVQKHARQLGCAVGSRQFNDAVRNLWVPRLLERIHADDSAAAAAADADADASRCCYSASPSHDELSSSHPAHRNAAPITGDDCARAPSPDVSSVVTGSSWSREASPTSQLFKSSSSTVEGCSTSTETEQCQNGCSSSATSVDMFDESWSELLARAIHDDDAEFGSGETGDSWWSLEDIWEQPLY