TFome Information for pUT5650

TFome Name pUT5650
Genbank Insert ID KJ727711
Protein Name ZmMYB101
Species Maize
TF Family MYB
Gene ID GRMZM2G425427
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: SE0089_F 3' Primer Name: SE0089_R
5' Primer Tm (º C): 61.2 3' Primer Tm (º C):
5' Primer Sequence: caccATGGATATGGACATGGACATGGC 3' Primer Sequence: GCTGCATGCGTGGTGATGATGAT
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98&d
Nucleotide Sequence: ATGGATATGGACATGGACATGGCCATGGCCATGGTGGGCTTCGATGAGGACATGGACCAGGTGCTGGCGGCCATGAGCCCCGCCGGGAGCTCCGCGACGTCGTCCGCGCCCACCGCCGCCGCCGCTCCACCAGCCGTCGTCGCAGCAGGCAGCAGCGACGACGACGAGGCCGGCGCCGCCGACCTCCGGAGGGGCCCCTGGACGGCGGAGGAGGACATCCTCCTCGTCAACTACATCGCCGCCCACGGCGAGGGCCGGTGGAACTCGCTCGCCCTCTCCGCGGGCCTGAAGCGCACCGGCAAGAGCTGCCGCCTGCGGTGGCTCAATTACCTGCGGCCCAACGTGCGGCGGGGCAACATCACCGCCGAGGAGCAGCTGCTGATCCTGGACCTGCACTCGCGCTGGGGCAACCGGTGGTCCAAGATCGCGCAGCACCTTCCTGGGCGCACCGACAACGAGATCAAGAACTACTGGCGCACCCGCGTGCAGAAGCACGCCAAACAACTCCGCTGCGACGTCAACAGCGCCCACTTCCGCCACATCGTGCGCCACGTCTGGATGCCGCGCCTCCTGGAGCGCGCCCAGGCCGACGCCAGATGCGGCGGCGTACAGGCTCCGGCCACCACCACGGCCAGCGCGCCGCCCGCGTGTTATAACTACTACGACGACGGCCGCCAACACTTGCTGCAGCAACAGGGAAGCGCCCACCACGGCGTGCCGGCGGCGAGCGAAGCTCACCACCACCACCAATACTACAGCGAGCCGGCAGGCCCGACGGCGGCGACGGCCACGGCCCTGAGCCCCGACGACGCGTCCAGCGCGCTGCGGCCGTCGTCGTCGCTCACGGCGGACGACGCGTCGCATTATGCTGCAGCTTACGCTTACACCTCGGCGGCCACGGCGACCCCGACGACAGACGACCAACAAGGCGTCCTGCACCACTGCGGCGCCGATGCAAGAACCGGGCCAACGCCGAGTGACGCCGCCGGTGACGACGACGTGTTTGCCGGGACGACTTGGTCAGAGCTTCTCGCCACCACCGCTACCGGCGGCCCTCACGAGGACTGCAGCTCCATGTCCATGATCGGCCTGCAGCTGCAGGACTTTGGGATAGGGTATTTCGAGGGCGGCCTCTGGAGCCTGGACGACCTTAGCTTAGAGCAGCCGTGCACGCTGAGCTCACCTGCTGATGCATATCATCATCACCACGCATGCAGC
TFome clones do not contain stop codon at 3'end.
translation: MDMDMDMAMAMVGFDEDMDQVLAAMSPAGSSATSSAPTAAAAPPAVVAAGSSDDDEAGAADLRRGPWTAEEDILLVNYIAAHGEGRWNSLALSAGLKRTGKSCRLRWLNYLRPNVRRGNITAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLRCDVNSAHFRHIVRHVWMPRLLERAQADARCGGVQAPATTTASAPPACYNYYDDGRQHLLQQQGSAHHGVPAASEAHHHHQYYSEPAGPTAATATALSPDDASSALRPSSSLTADDASHYAAAYAYTSAATATPTTDDQQGVLHHCGADARTGPTPSDAAGDDDVFAGTTWSELLATTATGGPHEDCSSMSMIGLQLQDFGIGYFEGGLWSLDDLSLEQPCTLSSPADAYHHHHACS