TFome Information for pUT5678

TFome Name pUT5678
Template BT087286.1
Genbank Insert ID KJ727737
Protein Name ZmMYB56
Species Maize
TF Family MYB
Gene ID GRMZM2G130149
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B282_F 3' Primer Name: B282_R
5' Primer Tm (º C): 65.1 3' Primer Tm (º C):
5' Primer Sequence: caccATGGTGACAGTGAGAGAGG 3' Primer Sequence: GAAGCAGGGCCCAACTCC
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGTGACAGTGAGAGAGGAGACTCGCAAGGGGCCATGGACAGAGCAGGAGGACCTGCAACTGGTATGCACTGTCCGTCTGTTCGGTGAACGTCGTTGGGATTTCATTGCCAAAGTATCAGGGCTCAACCGGACAGGCAAGAGCTGCCGGCTGCGCTGGGTCAACTACCTCCACCCTGGCCTCAAGCGTGGGCGCATGTCTCCCCATGAAGAGCGACTCATCCTAGAGCTGCACGCTCGGTGGGGAAACAGGTGGTCCAGGATAGCACGCCGCTTGCCAGGGCGCACTGACAATGAGATCAAGAACTACTGGAGGACACACATGAGAAAGAAGGCACAGGAGAGGAAGAGGAACATGTCTCCATCGTCGTCCTCGTCTTCGCTGACTTACCAGTCAGGCTACCCAGATACTCCATCAACCATTGGAGTTGAGGGACAGGAGCTTCATGGTGGCAGTGGCTGCATCACAAGCATCCTGAAGGGCACCCCTCCGGACATGGATGGCTATCCCATGGACCAGATATGGATGGAAATTGAGGCGCCACAGATGCCCTCGGAGGAGAGCTTTGTTGGGGGGAACCATAATGTGTGCAGCAGCCTTGCCACCCCGCTGCCACCACCAACTGTCTGGGAATACTACCCAGATGCCTGCTGGAAGGTTGACGATGAGATCAAGATGGCAACACAATTTCAATTTGGTTATAGTGAAGGAGTTGGGCCCTGCTTC
TFome clones do not contain stop codon at 3'end.
translation: MVTVREETRKGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGRMSPHEERLILELHARWGNRWSRIARRLPGRTDNEIKNYWRTHMRKKAQERKRNMSPSSSSSSLTYQSGYPDTPSTIGVEGQELHGGSGCITSILKGTPPDMDGYPMDQIWMEIEAPQMPSEESFVGGNHNVCSSLATPLPPPTVWEYYPDACWKVDDEIKMATQFQFGYSEGVGPCF