TFome Information for pUT5752

TFome Name pUT5752
Genbank Insert ID KJ727800
Protein Name ZmEREB184
Species Maize
TF Family AP2-EREBP
Gene ID GRMZM2G028151
transcript T02
Vector pENTR/SD/D-TOPO
Note c.C409A p.Q137K Not present in functional domain. Not present in template FlcDNA.
Request Information: Deposited to ABRC
5' Primer Name: B388_F 3' Primer Name: B388_R
5' Primer Tm (º C): 66.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGAAGAACATGACCAGACAGGAGTAC 3' Primer Sequence: TGCGTCGGTCCACGCGG
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGAAGAACATGACCAGACAGGAGTACGTCGCTCACCTGAGAAGGAAAAGCAGCGGCTTCTCGCGCGGCGCTTCGATCTACCGGGGAGTCACCAGGCATCACCAGCACGGGCGGTGGCAGGCGCGCATCGGCCGCGTCTCGGGCAACAAGGACCTCTACCTCGGAACGTTCAGCACCCAGGAGGAGGCGGCGGAGGCGTACGACGTGGCCGCGATCAAGTTCCGCGGCCTCAGCGCGGTCACCAACTTCGACATCACGCGGTACGACGTGGACAAGATCATGGAGAGCAGCACGCTGCTCCCGGGCGAGCAGGTCCGGCGCAGGAAGGAAGGCGCCGACGCCGCGGTCTCGGAGGCCGCCGCCGCGCTGGTGCAGGCCGGCAACTGCATGACGGACACCTGGAAGATCAAGGCGGCGCTGCCGGCTGCCGCGCGGGCCGACGAGCGCGGCGCCGGCCAGCAGCAGCGTCAGGACTTGCTGTCGAGCGAGGCCTTCTCGCTGCTCCACGACATCGTGTCCGTCGACGCCGCTGCTGGTACAGGGACAGGGGGCATGTCGAACGCGTCCTCGTCGCTGGCCCCCAGCGTGAGCAACTCCCGGGAGCAGAGCCCGGACCGGGGCGGCGCCAGCCTCGCCATGCTCTTCGCCAAGCCCGCCGCGGCGCCCAAGCTGGCTTGCCCGCTGCCGCTGGGGTCCTGGGTGTCGCCGTCCGCGGTGTCCGCCAGGCCGCCCGGCGTGTCAATCGCGCACCTGCCGGTGTTCGCCGCGTGGACCGACGCA
TFome clones do not contain stop codon at 3'end.
translation: MKNMTRQEYVAHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVSGNKDLYLGTFSTQEEAAEAYDVAAIKFRGLSAVTNFDITRYDVDKIMESSTLLPGEQVRRRKEGADAAVSEAAAALVQAGNCMTDTWKIKAALPAAARADERGAGQQQRQDLLSSEAFSLLHDIVSVDAAAGTGTGGMSNASSSLAPSVSNSREQSPDRGGASLAMLFAKPAAAPKLACPLPLGSWVSPSAVSARPPGVSIAHLPVFAAWTDA