TFome Information for pUT5753

TFome Name pUT5753
Template DR830295
Genbank Insert ID KJ727801
Protein Name ZmALF7
Species Maize
TF Family Alfin-like
Gene ID GRMZM2G107807
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B413_F 3' Primer Name: B413_R
5' Primer Tm (º C): 69.6 3' Primer Tm (º C):
5' Primer Sequence: caccATGGACGGAGGAGCCGG 3' Primer Sequence: AGCCTTGGCCCTCTTGCTTCC
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGGACGGCGACAGAGAAGGCGCTGCGGCGGTGCACCACCACGCGCGCTCCCCCGAGGACGTCTTCCGCGATTTCCGCGCGCGCCGCGCCGGCATCGTCAAGGCACTCACCACGGATGTGGAGAAGTTCTATCAGCAGTGCGATCCAGAGAAAGAGAACTTGTGCCTTTATGGTTTGCCAAATGAGACTTGGGAGGTTACTCTTCCAGCTGAGGAAGTACCTCCTGAGCTTCCAGAACCAGCACTGGGCATAAACTTTGCCCGTGATGGAATGGTTGAAAAAGACTGGTTGTCTCTAGTTGCAGTTCATAGTGATGCGTGGCTCCTGTCTGTTGCATTCTACTTTGGAGCTCGCTTTGGATTTGATAAAGATGCAAGGAGAAGGCTCTTCACCATGATTAATAACCTGCCCACTGTTTATGAAGTTGTGACCGGGGTTGCTAAGAAGCAATCAAAAGCCCCCAACGGCAGCAGCAAAAGCAGCAAATCTAACTCTAAACCATCAAAACAGATCAATTCTAACAGTAAGCCTGTGAAGCCAGCCCACCCAAACGAAGAGGAGGATAGCGGCCGTGAGGACGCAGAGGAGGACCAGGCGTACCTGTGTGGGTCCTGTGGGGAAAGCTATGCGAATGGGGAGTTCTGGATCTGCTGCGATATCTGCGAGAAGTGGTTCCATGGCAAGTGTGTCCGCATCACCCCTGCAAAGGCAGAGCACATCAAGCAGTACAAGTGTCCCAGCTGCAGCACCAAGCGGAGCCGGGAA
TFome clones do not contain stop codon at 3'end.
translation: MDGDREGAAAVHHHARSPEDVFRDFRARRAGIVKALTTDVEKFYQQCDPEKENLCLYGLPNETWEVTLPAEEVPPELPEPALGINFARDGMVEKDWLSLVAVHSDAWLLSVAFYFGARFGFDKDARRRLFTMINNLPTVYEVVTGVAKKQSKAPNGSSKSSKSNSKPSKQINSNSKPVKPAHPNEEEDSGREDAEEDQAYLCGSCGESYANGEFWICCDICEKWFHGKCVRITPAKAEHIKQYKCPSCSTKRSRE