TFome Information for pUT5754

TFome Name pUT5754
Template BT036116.1
Genbank Insert ID KJ727802
Protein Name ZmALF18
Species Maize
TF Family Alfin-like
Gene ID GRMZM2G008259
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B405_F 3' Primer Name: B405_R
5' Primer Tm (º C): 68.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGATATGGCCCCCGC 3' Primer Sequence: CTGCCTTATTTTCTTCGAGCTGCA
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGGACGGCGGCGGCACGCACCGCACGCCGGAAGACGTGTTCCGGGATTTCCGCGCGCGGCGGGCTGGTATGATCAAAGCGCTCACCACCGACGTGGAGAAGTTCTACCAGCAGTGTGACCCAGAGAAAGAGAATCTGTGTTTGTATGGTCTTCCCAATGAAACATGGGAAGTGAACTTGCCTGCAGAGGAGGTTCCTCCTGAACTTCCAGAGCCAGCTCTGGGAATTAATTTTGCTCGTGACGGGATGGATGAAAAAGATTGGCTGTCACTAGTCGCGGTGCACAGTGATGCTTGGTTGCTGGCTGTGGCCTTTTACTTCGGTGCAAGATTTGGTTTTGACAAAGAATCCAGGAAGCGCCTTTTTGTCATGATTAATAACCTCCCTACAATATATGAAGTTGTCACGGGAACTGCCAAGAAGCAAACCAAGGAGAAAACTCCGAAAAGCAGCAGCAAGAGCAATAAAGCTGGCCCAAAACCGCCACGCCAGCCAGAACCCAACTCAAGGGGTTCGAAGATGCCACCTCCGAAGGATGAGGATGACAGCGGAGGCGAGGAAGAGGAGGAAGAGGAAGATCACGAAAACACGCTGTGTGGTTCTTGTGGTGACAACTACGGACAGGATGAGTTCTGGATATGCTGCGATGCGTGCGAGACTTGGTTCCATGGCAAGTGTGTCAAGATCACTCCTGCCAAGGCCGAACACATCAAGCACTACAAGTGTCCGAACTGCAGCGGTAGTGGCAAGAGAGCCCGAGCA
TFome clones do not contain stop codon at 3'end.
translation: MDGGGTHRTPEDVFRDFRARRAGMIKALTTDVEKFYQQCDPEKENLCLYGLPNETWEVNLPAEEVPPELPEPALGINFARDGMDEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKESRKRLFVMINNLPTIYEVVTGTAKKQTKEKTPKSSSKSNKAGPKPPRQPEPNSRGSKMPPPKDEDDSGGEEEEEEEDHENTLCGSCGDNYGQDEFWICCDACETWFHGKCVKITPAKAEHIKHYKCPNCSGSGKRARA