TFome Information for pUT6466

TFome Name pUT6466
Genbank Insert ID KJ728192
Protein Name ZmMYB37
Species Maize
TF Family MYB
Gene ID GRMZM2G455869
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: CD0151_F 3' Primer Name: CD0151_R
5' Primer Tm (º C): 74.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGTGCACCAGGGGCCACTGGAGAC 3' Primer Sequence: CTGGGGATGAGAGACCCCAACCTCC
PCR Condition: PCR Conditions: Volumes per reaction (30l): 6 l GC
Nucleotide Sequence: ATGTGCACCAGGGGCCACTGGAGACCGTCGGAGGACGAGAAGCTGAAGGAGCTCGTCGCGCTCTACGGCCCGCACAACTGGAACGCCATCGCCGAGAAGCTTCAAGGGAGATCAGGGAAAAGCTGCAGGCTGAGGTGGTTCAACCAGCTGGACCCGAGGATCAACCGGAGCCCCTTCTCAGAGCAGGAGGAGGCGCTGCTCCTGGCGTCCCACCGCGTCCACGGCAACCGGTGGGCCGTCATCGCCAGGCTCTTCCCGGGGCGCACCGACAACGCCGTCAAGAACCACTGGCATGTGATCATGGCGCGGCGGTGCAGGGAGCGGATGAGGCTCTCGAACAGGGGCGGCGCCGCTGCTGGCCAGCATGGTGCCGTCGACACCGGTGCTGTGGAAGATGGCAGTAACCCTAGGAACGCCAAGAAGCTGAGGCCTGATGCCAGCAGCGTGGCCTCCTTCCTAGACAAGTACCGAAGAGAATTTTCCGTCGTCGTCCCGTTTGCTATTAACCATGATCGCAAGCAGCAGGACTATTGTTCAACTACTAACGAAGCAGACGCAAACAAATCGGTTGAATTCTACGATTTTCTCCAAGTGAATGCGAACTCGAGCGACACCAAGTGTGGTTCGAGCATCGAGGAGCAGGAGGAGAACCGGGATGATCAAGCCGAAGGGCAGGTGCAGTTCATAGACTTCCTGGAGGTTGGGGTCTCTCATCCCCAG
TFome clones do not contain stop codon at 3'end.
translation: MCTRGHWRPSEDEKLKELVALYGPHNWNAIAEKLQGRSGKSCRLRWFNQLDPRINRSPFSEQEEALLLASHRVHGNRWAVIARLFPGRTDNAVKNHWHVIMARRCRERMRLSNRGGAAAGQHGAVDTGAVEDGSNPRNAKKLRPDASSVASFLDKYRREFSVVVPFAINHDRKQQDYCSTTNEADANKSVEFYDFLQVNANSSDTKCGSSIEEQEENRDDQAEGQVQFIDFLEVGVSHPQ