TFome Information for pUT6533

TFome NamepUT6533
Genbank Insert IDKJ728256
Protein NameZmOrphan343
Species Maize
TF Family Orphans
Gene ID GRMZM2G074824
transcript T01
VectorpENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B918_F 3' Primer Name: B918_R
5' Primer Tm (º C): 69.9 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCTAGTGATGGCCTATGGGA 3' Primer Sequence: GTAGATTCGCTCAGCTGTGGAGA
PCR Condition: 10 l GC buffer (Thermo Fisher) 2 l primer forward
Nucleotide Sequence: ATGGCTAGTGATGGCCTATGGGATGTGGTAAGCAACCAGGACGTGCTGTCAATAATCAAGGACACGGTTAAAGAGCCTGGAATGTGCTCGAAGAGGTTGGCCACGGAGGCTGCGGAGCGGGGCAGCAAAGACAATATCACTGTCATTGTTGTCTTTCTTCGCCCCGTCTCCACAGCTGAGCGAATCTAC
TFome clones do not contain stop codon at 3'end.
translation: MASDGLWDVVSNQDVLSIIKDTVKEPGMCSKRLATEAAERGSKDNITVIVVFLRPVSTAERIY