TFome Information for pUT6677

TFome Name pUT6677
Genbank Insert ID KJ728393
Protein Name ZmMYB1
Species Maize
TF Family MYB
Gene ID GRMZM2G005066
transcript T01
Vector pENTR/SD/D-TOPO
Note alternative, functional C1 allele (allele from B73, which was synthesized asUT4076, is not functional)
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGCCGCAGGGCTTGCTGCGCTAAGGAGGGCGTTAAGAGAGGCGCTTGGACCAGCAAGGAGGACGACGCTCTTGCCGCTTACGTGAAGGCTCATGGCGAGGGCAAGTGGCGCGAGGTTCCACAAAAGGCTGGCCTTAGAAGGTGCGGCAAGTCTTGCAGGCTGCGCTGGCTGAACTACCTGAGGCCAAATATCAGGCGCGGCAACATCAGCTACGACGAGGAGGACCTCATGATCATCAGGCTGCATAGGCTGCTGGGCAACAGGTGGTCACTTATCGCTGGCAGACTGCCAGGCAGGACCGACAACGAGATCAAGAACTACTGGAACAGCACCCTCGGCAGAAGGGCTGGCGCAGGCGCTGGCGCTGGGGGCTCTAGAGTTGTTATCGCTCCAGACACCGGCAGCCACGCTACTCCAGCTGCTACTTCTGGCTCTGGCGAGACTGGCCAAAAGGGCGCTGCTCCAAGAGCTGACCCAGATTCTGCTGGCACCACCACCACATCTGCTGCTGCTGTTTGGGCCCCAAAGGCCGTTAGATGCACTGGCGGCCTGTTCTTCTTCCACCGCGATACCACTCCAGCTCACGCAGGCGAGACTGCTACTCCAATGGCTGGCGGCGGCCTTGGCGGCGAGGCTGGCTCATCTGAGGATTGCAGCTCTGCTGCTAGCGTGTCACCACTGGTGGGCTCTCAAGACGAGCCATGCTTCTCTGGGGACGGCGACTGCGACTGGATGGATGATGTTAGGGCCCTGGCCAGCTTCCTCGAGTCTGATGAGGATTGGCTGAGGTGCCAGACTGCTGGCCAACTTGCT
TFome clones do not contain stop codon at 3'end.
translation: MGRRACCAKEGVKRGAWTSKEDDALAAYVKAHGEGKWREVPQKAGLRRCGKSCRLRWLNYLRPNIRRGNISYDEEDLMIIRLHRLLGNRWSLIAGRLPGRTDNEIKNYWNSTLGRRAGAGAGAGGSRVVIAPDTGSHATPAATSGSGETGQKGAAPRADPDSAGTTTTSAAAVWAPKAVRCTGGLFFFHRDTTPAHAGETATPMAGGGLGGEAGSSEDCSSAASVSPLVGSQDEPCFSGDGDCDWMDDVRALASFLESDEDWLRCQTAGQLA