TFome Information for pUT6679

TFome Name pUT6679
Template DV020423
Genbank Insert ID KJ728395
Protein Name ZmMYB3
Species Maize
TF Family MYB
Gene ID GRMZM2G084799
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B295_F 3' Primer Name: B295_R
5' Primer Tm (º C): 77.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGGCGCCGTGCTGCG 3' Primer Sequence: GAACGAGTCGGACAGGAG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGAGGGCGCCGTGCTGCGAGAAGGTGGGGCTCAAGCGAGGGAGGTGGACGGCGGAAGAGGACCAGTTACTTGCCAACTACATTGCGGAGCACGGCGAGGGGTCCTGGAGGTCGCTGCCCAAGAATGCAGGCCTGCTCCGGTGCGGCAAGAGCTGCCGGCTCCGGTGGATCAACTACCTTCGGGCGGACGTCAAGAGGGGGAACATCTCCAAGGAGGAAGAAGACATCATCATCAAGCTCCACGCCACCCTCGGCAACAGGTGGTCCCTGATCGCCAGCCACCTCCCCGGCCGAACAGACAACGAGATCAAGAACTACTGGAACTCGCACCTCAGCCGGCAGATCCACACGTACCGCCGGAAATACACCGCCGGGCCTGACGACACCGCCATCGCCATCGACATGAGCAAGCTGCAGAGCGCCGACAGGCGGCGCGGCGGCAGGACCCCGGGCCGGCCGCCGAAGGCTAGCGCCAGCAGGACCAAGCAGGCGGACGCCGATCAGCCCGGCGGCGAGGCGAAAGGCCCGGCCGCGGCGGCGTCGAGCCCGCGGCACAGCGACGTGGTGAACCCGGGCCCGAACCAGCCCAACAGCAGCAGCGGCAGCACGGGCACGGCCGAGGAGGAGGGGCCCAGCAGCGAGGACGCGAGCGGGCCGTGGGTGCTGGAGCCGATAGAGCTCGGGGACCTAGTCTGGGGGGAGGCCGACAGCGAGATGGACGCCCTGATGCCTATCGGGCCCGGCGGCCACGACTCGGCTGCCCTCGAAGGGCTTGGCGCGGTCGGCTGCGAGGCCCAGGTGGACGACCTGTTCGACATGGACTGGGATGGCTTCGCGGCCCATCTGTGGGGCGGGCCGGAGCAGGACGAGCACAGCGCGCAGCTGCGGCAGGCCGCCGAGCCGCTGGAAGTTGCTGCTGCTGCTGCTGCTGCGACGGCGGCCCGCACCCCGGACGATCGCGAGCTGGAGGCGTTCGAGACTTGGCTCCTGTCCGACTCGTTC
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCEKVGLKRGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADVKRGNISKEEEDIIIKLHATLGNRWSLIASHLPGRTDNEIKNYWNSHLSRQIHTYRRKYTAGPDDTAIAIDMSKLQSADRRRGGRTPGRPPKASASRTKQADADQPGGEAKGPAAAASSPRHSDVVNPGPNQPNSSSGSTGTAEEEGPSSEDASGPWVLEPIELGDLVWGEADSEMDALMPIGPGGHDSAALEGLGAVGCEAQVDDLFDMDWDGFAAHLWGGPEQDEHSAQLRQAAEPLEVAAAAAAATAARTPDDRELEAFETWLLSDSF