TFome Information for pUT6819

TFome Name pUT6819
Genbank Insert ID KJ728514
Protein Name ZmMYB97
Species Maize
TF Family MYB
Gene ID GRMZM2G162434
transcript T01
Vector pENTR/SD/D-TOPO
Note This construct was synthesized with codon optimization for yeast.
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGTAGACCACCATGTTGTGACAAAGAAGGTATTAAGAAAGGTCCATGGACTCCAGAAGAAGATATCATCTTGGTTTCTTACATCCAAGAACACGGTCCAGGTAATTGGAGATCTGTTCCAATCAATACTGGTTTGATGAGATGCTCTAAGTCCTGTAGATTGAGATGGACCAATTACTTAAGACCAGGTATCAGAAGAGGTAACTTCACTCCACATGAAGAAGCTATTATCGTCCACTTGCAATCTTTGTTGGGTAATAGATGGGCTGCTATTGCTTCTTATTTGCCACAAAGAACCGATAACGACATCAAGAATTACTGGAACACCCACTTGAAGAAGAAGTTGAAAAAGCAACAAGCCATTGGTGCTATTTTTGCTCCTCCAGATTCTTCCTCTTCTTCATCTTCTATCGTTGTTCCACCAGCTGCTACTACTACTACAACTACTGTTGATCATCACCACAGAGATATGTTGGGTGCTAATTTGTTGGTTTCCTCTAAGGATACTTACTACTATGCTAGACCACCAGCTGAAGCTGCTGCTGTTGCTAGAAGATCTCCATTTGCTGCTGATGGTGATTCTTCTAGTTCTTCTTATGCTTCCTCCATGGACAACATCTCTAGATTATTGACTGGTTTCATGAAGCAACAACATGATGATGCTGCTGCAGCTGCTGATACAAAACCACCAGCTCCAGCTGCTCAAGTTAATTCTCCACCACCAGCTGCATTTTTGTCTCCATCTTTTCATCATCATATGTCCGCTGGTACTGGTTCTGGTACTCCTCCAGCTGCTTCTGCTGCTTACTTTAATGATATGATGCCACCACCACCACCTCAACAACAAGCTGCTTTGATGGGTGGTCATGGTGATTATGATGATGGTCCATCTTCTAGACAACACTTGCAACCATCTCCATTGTCTCCAATTGAAAAGTGGTTGTTTGAAGAAGCTGCTGAACAAGTTGGTGATTTGATGGATTTGTCTGAAGATTGCTGTTCCTCTGTTCCAATGATGTTCTGA
TFome clones do not contain stop codon at 3'end.
translation: MGRPPCCDKEGIKKGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYLRPGIRRGNFTPHEEAIIVHLQSLLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLKKQQAIGAIFAPPDSSSSSSSIVVPPAATTTTTTVDHHHRDMLGANLLVSSKDTYYYARPPAEAAAVARRSPFAADGDSSSSSYASSMDNISRLLTGFMKQQHDDAAAAADTKPPAPAAQVNSPPPAAFLSPSFHHHMSAGTGSGTPPAASAAYFNDMMPPPPPQQQAALMGGHGDYDDGPSSRQHLQPSPLSPIEKWLFEEAAEQVGDLMDLSEDCCSSVPMMF*