Tfome Clone Information

TFome Information for pUT3142

TFome Name pUT3142
Template BT062252.1
Genbank Insert ID JX469902
Protein Name ZmTUB7
Species Maize
TF Family TUB
Gene ID GRMZM2G163726
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: UT-2883up 3' Primer Name: UT-2883dn
5' Primer Tm (º C): 61.7 3' Primer Tm (º C):
5' Primer Sequence: caccATGTCCTTTCGCAGCATAGTCCGTG 3' Primer Sequence: TTCACAAGCCAGCTTGCTGTCGAAG
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98&
Nucleotide Sequence: ATGTCCTTTCGCAGCATAGTCCGTGATGTTAGGGAAAGCTTTGGTAGCTTATCAAGACGGAGCCTTGAGGTCAGGATTTCTGGTTTGCCTGGTCTGTCTGGTGGTCATCATAGAGGGAAATCTGTTGGATCTGTGAGTGACCTGCGCGACAGACCTGTAGTAGTTGATCAAAGCAGGTGGGTTGGTCTTCCTCCTGAATTGCTTCGAGATGTAATGAGAAGGCTTGAGGAAGGTGAGAGCAATTGGCCATCCCGGAAAAATGTTGTTGCCTGTGCAGCCGTCTGTGGAACATGGAGAGAGATATGCAAGGATATAGTGCTGAGCCCGGAGTTCTGCGGGAAGCTCACTTTTCCAGTATCACTTAAACAGCCGGGACCAAGAAATGGAATAATCCAGTGTTTCATAAAAAGGGACAAATCGACATCAACTTATTATCTTTACCTATGTCTTAGCCCTGTTGTCCTCAGCGAGGATGGGAAGTTTCTGCTAGCAGCTAAGAGGAATCGCCGTACAACATATACTGAGTACATCATTTCTGTGGATCCTAAAAGTATATCACGATCAAGTGATGGCTGTGTTGGAAAAATGAGGTCAAATTTTCTTGGCACTAAATTCATCGTGCATGACACTCGAGCACCACACAATGCTGGGAGCCTTGTCTCCTGTGAGCGCGGCAGCCGCAGAATCTCCTCTAGGAGGGTTTCCCCCAAGGTACCCACTGCCAGCTACCCCATTGCCCGGGTGAACTATGAGCTAAACCTGCTTGGCACAAGGGGGCCCAGGCGTATGAATTGCACGATGCATTCCATCCCAGCCTCAACGCTGGACCCTCAAGGCATGGTGCCTGAGCCTGGCCAACCCAAGCAGATCTTCGTCCCTGGCTCGTCGTCCTTCGAAGATTCCTTTCGCAGTGCAAACAACACCCCTTCCAGCTCAAGGTTCTCGGTCGCAGACCGCTCCTTGGATTGGAGCTCCTCTCGATTCTCAGAGACGAGCGGATTGGCTCAGCAGGACGACGATGACAGTGACCAGGCTAAGGAGAGGCCTTTGGTTCTCTGCAACAAGGAGCCAAGGTGGCACGAGCAGCTGCAGTGTTGGTGCCTCAACTTCCATGGTCGGGTGACCGTGGCTTCTGTGAAGAACTTCCAGTTGATAGCTGCACCACAACTAGATTCTGAACCGTCACAGCAAGCTCAGCAGCAAACCCAGCCTTCGAATTCGTCTTCAGCATCGGATCATGACAAAGTGATCCTGCAGTTTGGTAAGGTCGCCAATGACATGTTCACTATGGACTACCGATACCCACTCTCGGCATTCCAGGCCTTCGCCATCTGTTTGACCAGCTTCGACAGCAAGCTGGCTTGTGAA
TFome clones do not contain stop codon at 3'end.
translation: MSFRSIVRDVRESFGSLSRRSLEVRISGLPGLSGGHHRGKSVGSVSDLRDRPVVVDQSRWVGLPPELLRDVMRRLEEGESNWPSRKNVVACAAVCGTWREICKDIVLSPEFCGKLTFPVSLKQPGPRNGIIQCFIKRDKSTSTYYLYLCLSPVVLSEDGKFLLAAKRNRRTTYTEYIISVDPKSISRSSDGCVGKMRSNFLGTKFIVHDTRAPHNAGSLVSCERGSRRISSRRVSPKVPTASYPIARVNYELNLLGTRGPRRMNCTMHSIPASTLDPQGMVPEPGQPKQIFVPGSSSFEDSFRSANNTPSSSRFSVADRSLDWSSSRFSETSGLAQQDDDDSDQAKERPLVLCNKEPRWHEQLQCWCLNFHGRVTVASVKNFQLIAAPQLDSEPSQQAQQQTQPSNSSSASDHDKVILQFGKVANDMFTMDYRYPLSAFQAFAICLTSFDSKLACE