Tfome Clone Information

TFome Information for pUT3143

TFome Name pUT3143
Template BT055100.1
Genbank Insert ID JX469903
Protein Name ZmARID4
Species Maize
TF Family ARID
Gene ID GRMZM2G138976
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: UT-2894up 3' Primer Name: UT-2894dn
5' Primer Tm (º C): 58.6 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGGAAGGGCCTTCCTCATG 3' Primer Sequence: AGCATTTCGTGGTACAGATGCTGTATTT
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98&
Nucleotide Sequence: ATGATGGAAGGGCCTTCCTCATGGTCAGCCGTCAAGGCTAAATTAAAGCCTGCAACTATGAGGCCCATTCCTCACTCTCGAAAGCAACAAATGCATCCATTTATGGGTTTTCCTGAAACTTCCCTTCACGAAACTAGTATTGTGAAGCCAAGCTTGCCAGCTGCACCAACTGTGAAGCACAATTCAGTTTCTTCTGCCACAACCACGCACAGAAAATCAACATCAGGGCCGTCTCATACTCCCTCAGTCATTCAGTTAAATCCTCTGCCAATGAAGAAACACGGATGTGATAGGTTGCCTATCCAAGTGTGCTCTGAGGAGGATTTTTTGAAGGATGTCATGCAGTTTTTAATCCAGAGGGGCCACAATCGACTTGTACCTCACGGAGGACTAGCTGAATTTCCTGATGCAATCCTTAACGCCAAGCGCCTTGATCTTTATAACCTGTACAAAGAGGTGGTGTCTAGAGGTGGATTTTATGTGGGTAATGGCATAAACTGGAAGGGTCAAGTTTTTTCAAAGATGCGTAACCATACCGCAACAAACAGAATGACTGGTGTAGGTAACACGTTGAAAAGACATTACGAGACATACTTGTTGGAATATGAGTTGGCACATGATGACGTGGATGGCGAATGCTGCTTACTTTGTCACAGTAGCGCACCTGGAGATTGGGTGAACTGCGGTTTATGTGGTGAATGGGCTCACTTTGGCTGCGACAGACGACAAGGACTAGGCACTTTCAAGGATTACGCTAAGACAGATGGTTTGGAATACATCTGCCCCCACTGTAGCTTAGCAAACTACAAGAAGAAGCCACCACCACCAAAAGCAGCTAACGGTTTTTCAAATACAGCATCTGTACCACGAAATGCT
TFome clones do not contain stop codon at 3'end.
translation: MMEGPSSWSAVKAKLKPATMRPIPHSRKQQMHPFMGFPETSLHETSIVKPSLPAAPTVKHNSVSSATTTHRKSTSGPSHTPSVIQLNPLPMKKHGCDRLPIQVCSEEDFLKDVMQFLIQRGHNRLVPHGGLAEFPDAILNAKRLDLYNLYKEVVSRGGFYVGNGINWKGQVFSKMRNHTATNRMTGVGNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAPGDWVNCGLCGEWAHFGCDRRQGLGTFKDYAKTDGLEYICPHCSLANYKKKPPPPKAANGFSNTASVPRNA