Tfome Clone Information

TFome Information for pUT3214

TFome Name pUT3214
Template BT054474.1
Genbank Insert ID JX469952
Protein Name ZmEREB40
Species Maize
TF Family AP2-EREBP
Gene ID GRMZM2G164591
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C193_F 3' Primer Name: C193_R
5' Primer Tm (º C): 75.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGTGCGACGCGGCGCCGAG 3' Primer Sequence: GAGACAGAGCCGCAGGTCCGTGCAGAACC
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGTGCGACGCGGCGCCGAGGTACAGGGGCGTGCGGAAGCGGCCGTGGGGCCGGTTCGCGGCGGAGATCCGGGACCCGGCGAAGCGCGCGCGCGTCTGGCTCGGCACCTTCGACTCGGCCGAGGCCGCGGCGCGCGCCTACGACGTGGCCGCGCGGGCCCTGCGCGGCCCGCTCGCCAGGACCAACTTCCCCGCGCTCACCACCACCTCCCGCCGCCCCGCGCCCACGTGCAGCTCCGGCTCCACCGTCGAGTCCTCCAGCGGGCCCCGCGCCGGGGACCCCAGGGCCAGGGCGGCGCATCGCGGCCGTGCTGCTGCGAAGCCGCGGCGGCCCCCACGGCAGGCGCCGCCGCCGCCCACCGACGCCGACTGCCACAGCGACTGCGCGTCGTCGGCCTCCGTCGTGGACGACGGCGACGACGCGTCCACGGTCCGGTCGCGCGCGCGCCCGTCGCTCGATCTCAACCTCCCGGCGCCGCTCGACTTGGACGGTGGCCACGACCTCGGGTTCTGCACGGACCTGCGGCTCTGTCTC
TFome clones do not contain stop codon at 3'end.
translation: MCDAAPRYRGVRKRPWGRFAAEIRDPAKRARVWLGTFDSAEAAARAYDVAARALRGPLARTNFPALTTTSRRPAPTCSSGSTVESSSGPRAGDPRARAAHRGRAAAKPRRPPRQAPPPPTDADCHSDCASSASVVDDGDDASTVRSRARPSLDLNLPAPLDLDGGHDLGFCTDLRLCL