Tfome Clone Information

TFome Information for pUT3345

TFome Name pUT3345
Template DV530760
Genbank Insert ID JX469985
Protein Name ZmGRF12
Species Maize
TF Family GRF
Gene ID GRMZM2G067743
transcript T03
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: UT2872up 3' Primer Name: UT2872dn
5' Primer Tm (º C): 59.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGCTGAGCGGGCACG 3' Primer Sequence: GGAGATGCACCGATCACTCCC
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98&
Nucleotide Sequence: ATGATGCTGAGCGGGCACGGCGGCGGGAGGCGCCTGTTCACGGCGTCGCAGTGGCAGGAGCTGGAGCACCAGGCGCTCATCTTCAAATACATGGCCTCCGGCGCGCCCGTGCCGCACGACCTCGTCCTGCCGCTCCGCCTCGCCACCGGCGTCGACACCGCGCCCTCCCTCGCCTTCCCGCCCCAGCCTTCGCCGTCGCTGGCGTACTGGGGCTGCTATGGCGCGGGGGCGCCGTTCGGCCGCAAGGCGGAGGACCCGGAGCCCGGGCGGTGCCGGCGGACGGACGGCAAGAAGTGGCGATGCTCCAGGGAGGCCCACGGAGACTCCAAGTACTGCGAGAAGCACATCCACCGCGGGAAGAGCCGTTCAAGAAAGCCTGTGGAAGTGACCTCCCCCGCCGCCTACCGCCCGTCCGCGTTCTCCATCTCGCCGCCTCGCGCGGCCGACGCGCCGCCGCCGCCGCCGGGCCTCGGCCACCCGCAGCAGCAGCATCTCCGCCACGGCGCTCTCTCTCCAGCAGGCCGCGCCCACGCCGCTGGCGCTCTCCAGCTCCACCTCGACTCGAGCCTGCACGCGGCGTCGCCGCCGCCGTCCTACCACAGGTACGCCCACTCCCACGCTCACTACACGCCGCCGCCGCCGCCGTCGCTCTACGACTACGGGCAGTCCAAGGAGCTTCGGGAGGCGGCGGAGCTCAGGCGGCGGCACTTCCACGCGCTCGGGGCCGACCTGAGCCTCGACAAGCCGCTGGCCGACGCCGGGGCCGCGGAGAAGCCCCTGCGGCGTTTCTTCGACGAGTGGCCGCGGGAGAGAGGCGACACGAGGCCGTCGTGGGCGGGGGCGGAGGACGCGACGCAGCTCTCCATCTCCATCCCCGCGGCTTCGCCCTCCTCTGACCACGCTGCCTCTGCCGCCGCGCGATGCCACAACGATGGGAGTGATCGGTGCATCTCC
TFome clones do not contain stop codon at 3'end.
translation: MMLSGHGGGRRLFTASQWQELEHQALIFKYMASGAPVPHDLVLPLRLATGVDTAPSLAFPPQPSPSLAYWGCYGAGAPFGRKAEDPEPGRCRRTDGKKWRCSREAHGDSKYCEKHIHRGKSRSRKPVEVTSPAAYRPSAFSISPPRAADAPPPPPGLGHPQQQHLRHGALSPAGRAHAAGALQLHLDSSLHAASPPPSYHRYAHSHAHYTPPPPPSLYDYGQSKELREAAELRRRHFHALGADLSLDKPLADAGAAEKPLRRFFDEWPRERGDTRPSWAGAEDATQLSISIPAASPSSDHAASAAARCHNDGSDRCIS