Tfome Clone Information

TFome Information for pUT4622

TFome Name pUT4622
Template Synthesized template
Genbank Insert ID KJ727232
Protein Name ZmSRS2
Species Maize
TF Family SHI/STY (SRS)
Gene ID GRMZM2G080295
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGCCGGCTTCCCACTTGGTGGCGGCTCTCATACTCAGAGCAGGGACGCTCCAGCTAGCTCTGTGCCACCAGTGCATCCTTCCGACGCTGCCTCATTCCTGTACGCTGCTAGAGCTGGCGCTGGCCTTCAGCTTTGGCAGCAGCAGCAACAGCACCCGTTCTACAACAGCAACATCATCAGGTTCAGCGACGACCCACCAGGCGCTGCTCCATCTCTTACTGGTGCTGCTAGCCCAAGCAGCCCATCTAGAGGTCCAAGAGCTGGCGGTGGTTCTGGCGGTGGTGGTGGTGTTTCTTGCCAGGATTGCGGCAACCAGGCCAAGAAGGACTGCGTTCACCAGAGGTGCAGGACCTGCTGCAAGTCTAGAGGCTTCGCTTGCAGCACCCACGTGAAGTCTACTTGGGTGAGCGCTGCTAAGAGGCGCGAGAGGCAGCAACAGCTTGCTGCTTTGGCTGCTTCTGCTGGCGATACCGCTGCTGCTGCTGGTCCATCTAGGGATCCTACCAAGAGGCCAAGGGCTAGGCTGTCTGTGGCTACCCCAACCACTACCAGCTCTGGCGATCAGCAGATGGTGACCGTGGCTGAGAGGTTCCCAAGAGAGGTGTCCAGCGAGGCTCTGTTCAGATGCGTTAGGCTGGGCCCAGTGGATAGGGCTGAGGCTGAAGTGGCTTACCAGACCACCGTTTCTATCGGCGGCCACGTGTTCAAGGGCATCCTGCATGATGTTGGCCCACGCTCTCTTCCAGCTGCTGGTGGCGGTGCTGCAGCTGCTGCTATCGAGTACTACTTCAGGCACGCTGCTGACGGCAGCCCACCATCTACTACAGGTGCTGCTGGTGAGGCTTGCGGCGCTGGTGGTGTTGGCAACGTGGTGGTTTCTAGCGCCGTGGTGATGGACCCATACCCAACTCCAGGCCCGTACACCGCTTTTTTGCCAGGCGCTCCATTCTTCCCAGGCCACCCAAGACAA
TFome clones do not contain stop codon at 3'end.
translation: MAGFPLGGGSHTQSRDAPASSVPPVHPSDAASFLYAARAGAGLQLWQQQQQHPFYNSNIIRFSDDPPGAAPSLTGAASPSSPSRGPRAGGGSGGGGGVSCQDCGNQAKKDCVHQRCRTCCKSRGFACSTHVKSTWVSAAKRRERQQQLAALAASAGDTAAAAGPSRDPTKRPRARLSVATPTTTSSGDQQMVTVAERFPREVSSEALFRCVRLGPVDRAEAEVAYQTTVSIGGHVFKGILHDVGPRSLPAAGGGAAAAAIEYYFRHAADGSPPSTTGAAGEACGAGGVGNVVVSSAVVMDPYPTPGPYTAFLPGAPFFPGHPRQ