Tfome Clone Information

TFome Information for pUT5669

TFome Name pUT5669
Template BT033411
Genbank Insert ID KJ727729
Protein Name ZmSRS7
Species Maize
TF Family SHI/STY (SRS)
Gene ID GRMZM2G135783
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B845F 3' Primer Name: B845R
5' Primer Tm (º C): 63.6 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCGGGGTTCCCTCTAG 3' Primer Sequence: CTGTCTCGGGTGGCCGTGGAA
PCR Condition: Step 1, 98°C 40 sec melt, 1 cycle; Step 2, 98&
Nucleotide Sequence: ATGGCGGGGTTCCCTCTAGGTGGAGGAGGCCACAGCCGCGACGCCCCCGCGTCGTCCGTCCCGCCGGTGCACCCCTCCGACGCAGCGTCCTTCCTCTACGCCGCGCGCGCGGGAGCGGGCCTGCAGCTATGGCAGCAGCACGAGCAGCAACAGCAGCACCCGTTCTACACCTCCAACATCATCCGCTTCTCCGATGACCCGACCGGCGCCCCGCCCTCGCTCACGGGCGCCGCGTCGTCGTCGTCTTCGCGCGGCACGAGGGGCGGCGCGGGAAGCGGCGGCGGAGGCGGCGGCGGGGTCAGCTGCCAGGACTGCGGCAACCAGGCCAAGAAGGACTGCGTGCACCAGCGCTGCCGCACCTGCTGCAAGAGCCGCGGCTTCACCTGCAGCACCCACGTCAAGTCCACCTGGGTCCCTGCCGCCAAGAGACGCGAGCGCCAGCAGCAGCTCGCCGTGCTAGCGGCCTCCGCCGCCGCCACAACCGCCGGCGCCGGCCCATCCCGCGACCCGACCAAGCGCCCTCGCGCGCGCCTCTCCGTCGCCACCCCCGCCACGTCCTCGGGGGATCAGCAGATGGTCACGGTCGCGGAGAGGTTCCCACGGGAGGTGAGCTCGGAGGCGGTGTTCCGGTGCGTGCGCCTGGGGCCGGTCGACCAGGCCGAGGCGGAGGTCGCGTACCAGACCACCGTCAGCATCGGCGGCCACGTGTTCAAGGGCATCCTTCACGACGTTGGCCCTCACAGCTTGCCTGCCGCTGGAGTCGGAGGCGGCGCCATCGAGTACCACTTCCGCCACGCCGGGGACGGATTGCCGCCGAGCACGGCAGCCACTGGCGAAGCAGGCGGCGGTGGCGTGGGGAGTGTCGTCGTGTCATCGGCTGTGGTGATGGACCCGTACCCGACGCCCGGACCCTACGCCGCCTTCCCCGCCGGCGCGCCGTTCTTCCACGGCCACCCGAGACAG
TFome clones do not contain stop codon at 3'end.
translation: MAGFPLGGGGHSRDAPASSVPPVHPSDAASFLYAARAGAGLQLWQQHEQQQQHPFYTSNIIRFSDDPTGAPPSLTGAASSSSSRGTRGGAGSGGGGGGGVSCQDCGNQAKKDCVHQRCRTCCKSRGFTCSTHVKSTWVPAAKRRERQQQLAVLAASAAATTAGAGPSRDPTKRPRARLSVATPATSSGDQQMVTVAERFPREVSSEAVFRCVRLGPVDQAEAEVAYQTTVSIGGHVFKGILHDVGPHSLPAAGVGGGAIEYHFRHAGDGLPPSTAATGEAGGGGVGSVVVSSAVVMDPYPTPGPYAAFPAGAPFFHGHPRQ