Tfome Clone Information

TFome Information for pUT6073

TFome Name pUT6073
Template BT086398.1
Genbank Insert ID KJ727961
Protein Name ZmTUB3
Species Maize
TF Family TUB
Gene ID GRMZM2G046816
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGCCATTCCGTAGCATCGTGCGTGATGTAAGGGATGGTTTCGGGAGCTTGTCTAGGAGGGGATTTGAGGTCAGGTTTCTGAGTCATCGCAGAGGGAAATCTCATGGTGCTGTCCATGAGCTGCACGACCCAGTGCTTGTGGTACAGAGTAGCTGCTGGGCTAGCTTGCCTCCTGAATTACTTCGAGATGTGATTGAGAGGTTGGAGACCAGTGAGGATACATGGCCTTCTAGGAAACATGTAGTTGCTTGTGCAGCTGTCTGCAGAACATGGAGAGAGATGTGTAGAGAGATTGTCAAGAGCCCAGAGTTTTCTGGAAAAATCACTTTTCCTGTTTCCTTGAAGCAGCCTGGGCCTCGAGATGGAACTATTCAGTGTTTTATTAAGAGGGATACATCTACCCAAATCTACAGTCTGTACCTTAGTTTTAGCTCTGCCGTGCCTGTCGAAAATGGCAAATTCCTTCTATCCGCAAAAAGGAACTGCCGTGCAACATATACAGAATATATAATATCAATAAATTCTGGTGATACATCTAGGTGTACAAGTAACAACACATACATTGGGAAATTAAGGTCAAATTTCCTTGGCACAAAATTTGTAATATACGATACTCATCCGCCATACAATGGAACTAGTCAAACAGTGGCAGGGAAAACAAGTCAGAGATTCTACTCCAAGAAGGGATCAACCAAGGTTTCTTGCAGGTGGTACAGTATTGCACAAATCTCATACGAGCTGAATGTCTTGGGAACTCGAGGCCCAAGGCGGATGAACTGTGTAATGCACTCCATCCCAGCTTCATGCCTTGAGGCTGGTGGCAGTGTCCCTTGCCAGCCGGACAGCATTGCAGCCCACTCTGTTGGCGGATCATTCAGCAGTGTGTCCTTGTCAAAGTCATCGACTATGGACCACTCTATGCATTTCACCAGTTCCCGGCTCTCTGATGCCATAACAGGAGATGGCATTGTGAACAGAGGCCAGGCATTGAATGATGCTGACGATGAAGAGTGCAAGGACATGCCTTTGATCCTCCGCAACAAGGCCCCAAGGTGGCACGAGCAGCTTCAGTGCTGGTGCCTCAACTTCCGGGGCCGGGTGACTGTCGCCTCGGTCAAGAACTTCCAGCTAGTCGCGGCGACACAGCCTGCCGCCGGAGCCCTGACCCCATCACAGGCAGCCCCGCAGCCAGCTCCGCCTCCTCCGCCGGACCAAGAGAAGGTCATACTGCAGTTTGGGAAGGTCGGCAAGGACATCTTCACCATGGACTACTGCTACCCGCTGTCAGCCTTCCAGGCCTTCGCCATCTGCCTGAGCAGCTTCGACACCAAGTTGGCCTGCGAA
TFome clones do not contain stop codon at 3'end.
translation: MPFRSIVRDVRDGFGSLSRRGFEVRFLSHRRGKSHGAVHELHDPVLVVQSSCWASLPPELLRDVIERLETSEDTWPSRKHVVACAAVCRTWREMCREIVKSPEFSGKITFPVSLKQPGPRDGTIQCFIKRDTSTQIYSLYLSFSSAVPVENGKFLLSAKRNCRATYTEYIISINSGDTSRCTSNNTYIGKLRSNFLGTKFVIYDTHPPYNGTSQTVAGKTSQRFYSKKGSTKVSCRWYSIAQISYELNVLGTRGPRRMNCVMHSIPASCLEAGGSVPCQPDSIAAHSVGGSFSSVSLSKSSTMDHSMHFTSSRLSDAITGDGIVNRGQALNDADDEECKDMPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAATQPAAGALTPSQAAPQPAPPPPPDQEKVILQFGKVGKDIFTMDYCYPLSAFQAFAICLSSFDTKLACE