Protein ZmWRKY120
ZmWRKY120 is a protein in the WRKY family.
Information
TF Name: ZmWRKY120
Species: Maize
TF Family: WRKY
Gene Name(Synonym): WRKY120
Uniprot ID: A0A1D6PDQ1

Protein ZmWRKY120

ZmWRKY120 is a protein in the WRKY family. NOTE the "Uniprot ID" shown on the right is a placeholder for testing. The interactive structure shown is based on that id.

Protein-DNA Interactions

Meme Logos for Maize v4 Gene IDs


Gene IDTypeMEME LogoSequenceFIMOPosition
Zm00001d041958DAPseq no logo sequence fimo position
Zm00001d041958DAPseq no logo sequence fimo position
Zm00001d041958ChIPseq no logo sequence fimo position
Zm00001d041958PChIPseq no logo sequence fimo position

Interactions where ZmWRKY120 is the regulator


There are no protein-dna interactions that fit this criteria.

Interactions where ZmWRKY120 is the target  
Expand


There are 181 protein-dna interactions that fit this criteria. download excel sheet

Zm00001eb139800_T001 from maize genome v5

Amino Acid Sequence
Copy to clipboard

MEEEEGSSTSSVAVPVPPPPNKYDSWTTDPEELMMMMVDEAAVQQEGPRRRRDSMLNKLISTVYSGPTISDIESALSFTG
GGDVDARNYNNSSAGPGALSSPEKVLMSKMENKYTLKIKTCGNGSSLAEDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCN
AKKQVERSTDEPDTLVVTYEGLHLHYTYSHFLHHQQPPPQPKKPKLGAGPPQQPIVVMDDDLLHGPAQQDIITTGPLGAA
VMAPAPAPPPAAASFCYDLDDDVPAFFDDHDHHHHQQQHITNGGLLEDMVPLLVRRPCTTTTTTSAGSTSPDLSASSSVS
WNPTSPYIDMAILSNIF

MEEEEGSSTSSVAVPVPPPPNKYDSWTTDPEELMMMMVDEAAVQQEGPRRRRDSMLNKLISTVYSGPTISDIESALSFTG
GGDVDARNYNNSSAGPGALSSPEKVLMSKMENKYTLKIKTCGNGSSLAEDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCN
AKKQVERSTDEPDTLVVTYEGLHLHYTYSHFLHHQQPPPQPKKPKLGAGPPQQPIVVMDDDLLHGPAQQDIITTGPLGAA
VMAPAPAPPPAAASFCYDLDDDVPAFFDDHDHHHHQQQHITNGGLLEDMVPLLVRRPCTTTTTTSAGSTSPDLSASSSVS
WNPTSPYIDMAILSNIF

Secondary Structure Color Code
BEND region with high backbone curvature without specific hydrogen bonding
HELX_LH_PP_P left-handed polyproline helix
HELX_RH_3T_P right-handed 3-10 helix
HELX_RH_AL_P right-handed alpha helix
HELX_RH_PI_P right-handed pi helix
STRN beta strand
TURN_TY1_P type I turn
UNDETERMINED no data available

Nucleotide Sequence
Copy to clipboard
     
Expand

GGTGGCTTCTTCTTGCATTGCATTG...

Zm00001d041958_T001 from maize genome v4

Amino Acid Sequence
Copy to clipboard

MEEEEGSSTSSVAVPVPPPPNKYDSWTTDPEELMMMMVDEAAVQQEGPRRRRDSMLNKLISTVYSGPTISDIESALSFTG
GGDVDARNYNNSSAGPGALSSPEKVLMSKMENKYTLKIKTCGNGSSLAEDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCN
AKKQVERSTDEPDTLVVTYEGLHLHYTYSHFLHHQQPPPQPKKPKLGAGPPQQPIVVMDDDLLHGPAQQDIITTGPLGAA
VMAPAPAPPPAAASFCYDLDDDVPAFFDDHDHHHHQQQHITNGGLLEDMVPLLVRRPCTTTTTTSAGSTSPDLSASSSVS
WNPTSPYIDMAILSNIF

Nucleotide Sequence
Copy to clipboard
     
Expand

TGGGTTGGTGGCTTCTTCTTGCATT...


Copyright © 2023 Grassius.org | Last updated: 2023-06-26