Tfome Clone Information

TFome Information for pUT1131

TFome Name pUT1131
Template EB817690
Genbank Insert ID HQ858675
Protein Name ZmMYB6
Species Maize
TF Family MYB
Gene ID GRMZM2G047626
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B54 UP 3' Primer Name: B54 DN
5' Primer Tm (º C): 57.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGTGACAGTGAGAGAG 3' Primer Sequence: GTAATCAGACCCAATATATATGgta
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGTGACAGTGAGAGAGGAGACTCGCAAGGGGCCATGGACAGAGCAGGAGGACCTGCAACTGGTATGCACTGTCCGTCTGTTCGGTGAACGTCGTTGGGATTTCATTGCCAAAGTATCAGGACTCAACCGGACAGGCAAGAGCTGCCGGCTGCGGTGGGTCAACTACCTCCACCCTGGCCTCAAGCGTGGGCGCATGTCTCCCCATGAAGAGCGCCTCATCCTTGAGCTGCACGCTCGGTGGGGAAACAGGTGGTCCAGGATAGCACGGCGCTTGCCAGGGCGCACTGACAATGAGATCAAGAACTACTGGAGGACACACATGAGGAAGAAAGCACAGGAGAGGAAGAGGAACATGTCTCCATCATCATCCTCATCTTCACTGAGTTACCAGTCAGGCTACCCAGATACTCCATCAATCATTGGAGTTAAGGGACAGGAGCTTCATGGTGGCAGTGGCTGCATCACAAGCATCCTGAAGGGCACCCATCCGGACATGGATGGCTATCCCATGGACCAGATATGGATGGAAATTGAGGCGCCAGAGGTGCCCTCGGAGGTGGGCTTTGTTGGAGGGAACGAAAATGTGTGCAGCAGCCTTGCCACCCCTCTGCCACCACCTACCGTCTGGGAATACTACCCAGAGGTCTGCTGGAAGCTTGACGATGAGATCAAGATGGCACCACAATTTGGTTATATAGTGAAGGAGCTGACCCCTGCTTCTGATACCATATATATTGGGTCTGATTAC
TFome clones do not contain stop codon at 3'end.
translation: MVTVREETRKGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGRMSPHEERLILELHARWGNRWSRIARRLPGRTDNEIKNYWRTHMRKKAQERKRNMSPSSSSSSLSYQSGYPDTPSIIGVKGQELHGGSGCITSILKGTHPDMDGYPMDQIWMEIEAPEVPSEVGFVGGNENVCSSLATPLPPPTVWEYYPEVCWKLDDEIKMAPQFGYIVKELTPASDTIYIGSDY