Tfome Clone Information

TFome Information for pUT1137

TFome Name pUT1137
Template EE039390
Genbank Insert ID HQ858681
Protein Name ZmMYB22
Species Maize
TF Family MYB
Gene ID GRMZM2G096358
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C17 UP 3' Primer Name: C17 DN
5' Primer Tm (º C): 60.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGTCCCAGAGGAAAGGC 3' Primer Sequence: GATACCTCCTCTCCATTGatgc
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGTCCCAGAGGAAAGGCGCCATGGCGGCTGCAGTGACGGCCAGCAAGCATCGCGAGGACCAGGAGGCGATGATGGTGGAGCTCAGGAGAGGCCCCTGGACGCTCGAGGAAGACAACCTCCTCATGAACTACATTGCTTGCCACGGCGAGGGCCGCTGGAATCTCCTCGCCCGCTGCTCCGGGTTGAAGAGGACCGGCAAGAGCTGCCGGCTCAGGTGGCTCAACTACCTGAAGCCCGACATCAAGCGCGGCAACCTGACGCCTGAGGAGCAGCTGCTCATCCTCGAGCTCCACTCCAAGTGGGGGAACAGGTGGTCGAGGATAGCGCAGCACCTGCCGGGGCGCACCGACAACGAGATCAAGAACTACTGGCGGACGCGCGTGCAGAAGCAGGCGCGGCAGCTGCGGGTGGACGCCAACAGCGCCGTCTTCCGCGACGCCGTCCGCTGCTACTGGATGCCGCGCCTGCTGGAGAAGATGGCCGCGCACCACCACGGCGACGGCGAGCTGCCGCCGCCACTGCACCCCTCGCACAACATCGCCGGCACGGCCTCCTCGCGCTCGCCGCCGGCCCACGGCAGCCAGCAGGAGGACCCGAGTAGTAGCGCGCCGGCGGCCAGCGGCCACTACCTGCAGCAGGTCGACCCGAGCCCGAGCACGTCGACGACGTCCGGGTCGACGACCTCGGCCGCGCTCCCGCCGGTGCCCTGCTTCTCCGAATCCGAACTAAGGTGGGTCGTGGACCAGTACGGCGCCGCTTACGGTTACACCGACGACCTCGACCTCGACGGCGGCGCCGGCGTGGTCGACGACGACTCGGCTGCCGCCGCCGCGCTGGACAGCCTCGGGCTGGACGGGCTGGACCTGGGGCCCGCCGACGGCGGCGTGTACTCGGACGCGACGCTGCTGGACTACCTCAACGCCACGTGCGCCGGCGGCACCACCGTGATGACAATGATGGGCGGCGTCCACGGCGCCGCGGGCGGTGGCGACGGCGACTACGGTCCGTCGCCGTGGCGGACGGACGAGCTCGGCCAGACGGCGAGGAAGCTCGGCGATCCTCAGCATCAATGGAGAGGAGGTATC
TFome clones do not contain stop codon at 3'end.
translation: MSQRKGAMAAAVTASKHREDQEAMMVELRRGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDIKRGNLTPEEQLLILELHSKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLRVDANSAVFRDAVRCYWMPRLLEKMAAHHHGDGELPPPLHPSHNIAGTASSRSPPAHGSQQEDPSSSAPAASGHYLQQVDPSPSTSTTSGSTTSAALPPVPCFSESELRWVVDQYGAAYGYTDDLDLDGGAGVVDDDSAAAAALDSLGLDGLDLGPADGGVYSDATLLDYLNATCAGGTTVMTMMGGVHGAAGGGDGDYGPSPWRTDELGQTARKLGDPQHQWRGGI