Tfome Clone Information

TFome Information for pUT1148

TFome Name pUT1148
Template AM156905
Genbank Insert ID HQ858692
Protein Name ZmMYB8
Species Maize
TF Family MYB
Gene ID GRMZM2G041415
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: D2 UP 3' Primer Name: D2 DN
5' Primer Tm (º C): 63.6 3' Primer Tm (º C):
5' Primer Sequence: CAC CAT GGG GAG GTC GCC G 3' Primer Sequence: GCTCTCACTCCCTTGGCCA
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGGGAGGTCGCCGTGCTGCGAGAAGGCGCACACGAACAAGGGCGCCTGGACCAAGGAGGAGGACCAGCGGCTCGTCGCCTACATCAAGGCCCACGGCGAAGGCTGCTGGAGGTCGCTCCCCAAGGCCGCGGGCCTGCTGCGCTGCGGCAAGAGCTGCCGCCTCCGGTGGATCAACTACCTGCGCCCCGACCTCAAGCGCGGCAACTTCACCCAGGAGGAGGACGACGTCATCATCAAGCTCCACCAGGTCCTCGGAAACAAGTGGTCGCTGATCGCCGCCCAGCTGCCGGGGCGGACGGACAACGAGATCAAGAACTACTGGAACACGCACATCAAGCGCAAGCTCATCGCCCGGGGCATCGACCCACGGACGCACCAGCCGGCGAGTGCCGCCGCAGTTGCCCCCGCCGCCGCCGCCGCCGCCGCCGCGCAAAGCAGCTTTCGCCACCATGGCGACGACGAGGCGGTGGCGCGGCGCAGCTGCTCGCGAGACAGCGGCTGCATCGCGGCGCACAGCAGCGACGACGACGACAGCACGTCCGGGTCCCTGCCACACCAACATGCTGTCGGCGGCATCGACCTCAACCTCTCGCTAAGCCCACCGACGAGCCAACCGTCATCGCCGGCCGCCGCCAAGGGAGTTGTAGCTAGCGGATATGGCCAAGGGAGTGAGAGC
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTQEEDDVIIKLHQVLGNKWSLIAAQLPGRTDNEIKNYWNTHIKRKLIARGIDPRTHQPASAAAVAPAAAAAAAAQSSFRHHGDDEAVARRSCSRDSGCIAAHSSDDDDSTSGSLPHQHAVGGIDLNLSLSPPTSQPSSPAAAKGVVASGYGQGSES