Tfome Clone Information

TFome Information for pUT1150

TFome Name pUT1150
Genbank Insert ID HQ858694
Protein Name ZmMYB42
Species Maize
TF Family MYB
Gene ID GRMZM2G419239
transcript T01
Request Information: Deposited to ABRC
5' Primer Name: D4 UP 3' Primer Name: D4 DN
5' Primer Tm (º C): 65.0 3' Primer Tm (º C):
5' Primer Sequence: CAC CAT GGG GCG GTC GCC 3' Primer Sequence: CTTCATCTCCAGGCCTCTgaag
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
TFome clones do not contain stop codon at 3'end.
translation: mgrspccekahtnrgawtkeederlvayvrahgegcwrslpraagllrcgkscrlrwinylrpdlkrgnftadeddlivklhsllgnkwsliaarlpgrtdneiknywnthirrkllgsgidpvthrrvaggaattisfqpspnsaaaaaaaetaaqapikaeetaavkaprcpdlnldlcisppcqheddgeeedeeldlkpafvkrealqaghghghglclgcglggqkgaagcscsnghhflglrtsvldfrglemk