Tfome Clone Information

TFome Information for pUT1157

TFome Name pUT1157
Template DR785526
Genbank Insert ID HQ858701
Protein Name ZmMYB50
Species Maize
TF Family MYB
Gene ID GRMZM2G145444
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B33 UP 3' Primer Name: B33 DN
5' Primer Tm (º C): 61.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGAGTGGAGTCGGAG 3' Primer Sequence: CGGCCGTGTGACGACGCC
PCR Condition: Step 1, 95C 4 min melt, 1 cycle; Step 2, 95C 30 se
Nucleotide Sequence: ATGGGAGTGGAGTCGGAGTGCGACAGGATAAAGGGCCCCTGGAGCCCCGAGGAGGACGAGGCGCTGCGGCGTCTCGTGGAGCGCCACGGCGCGCGGAACTGGACGGCGATCGGGCGCGGCATCCCGGGGCGGTCGGGGAAGTCGTGCCGGCTGCGGTGGTGCAACCAGCTGTCGCCGCAGGTGGAGCGCCGCCCCTTCACGCCCGAGGAGGACGCCGCGATCCTGGCCGCGCACGCCCGGCTGGGCAACCGGTGGGCCGCCATCGCGCGCCTTCTCCCGGGGCGCACCGACAACGCCGTTAAGAACCACTGGAACTCGTCGCTCAAGCGGAAGCTCGCCACCGCCACGGCGACCTCCAGCGGCAGCGATGCTGAGCGGGCGTGCAAGCGCGCAAGCCCTGGCCCGGGGAGCCCGACGGCGTCGGACCGCAGCGACCTCAGCCACGGCTGCGGCGCCGCGCAGGTGTTCCGTCCCGTCCCGCGCGCCGGAGGCTTCGACGCCATCAGCGCCGCAGACGTGCGCCCTCCGCCCCCGCCAGCAGTCGCAGACGAGGACCCGCTCACCTCGCTCTCCCTCTCGCTGCCGGGGCTGGACCAGTCGCCGTCGGGCTTCCACCACGACAGCGCCCGGAGCCACTTCCAGGAGCTCTCCCCCTCGTCGTCCCCGTCGCCGCAGTCTACTCCACCCGCCTTCCCTCCGCAGGCGGCTCCGTCTCAGTCGTCGTACGCGTTCAGCGGCGAGCTGGTTGCCGCGATGCAGGAAATGATCCGCGCCGAGGTGCGCAAGTACATGTCCGGCGCGGGGCTCCGCGCCGGATGCGGGCCCGGGGCCGTGGGCGAGGTGTGCATGCCGCAGCTGGTGGAGGGTGTGATGCGCGCCGCCGCGGAGCGCGTCGGCGTCGTCACACGGCCG
TFome clones do not contain stop codon at 3'end.
translation: MGVESECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWCNQLSPQVERRPFTPEEDAAILAAHARLGNRWAAIARLLPGRTDNAVKNHWNSSLKRKLATATATSSGSDAERACKRASPGPGSPTASDRSDLSHGCGAAQVFRPVPRAGGFDAISAADVRPPPPPAVADEDPLTSLSLSLPGLDQSPSGFHHDSARSHFQELSPSSSPSPQSTPPAFPPQAAPSQSSYAFSGELVAAMQEMIRAEVRKYMSGAGLRAGCGPGAVGEVCMPQLVEGVMRAAAERVGVVTRP