Tfome Clone Information

TFome Information for pUT1183

TFome Name pUT1183
Genbank Insert ID HQ858805
Protein Name OsOrphan19
Species Rice
TF Family Orphans
Gene ID LOC_Os02g39360
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 0.0 3' Primer Tm (º C): 0.0
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
TFome clones do not contain stop codon at 3'end.
translation: mkiqcdacesaaaavvccadeaalcaacdvevhaanklagkhqrlplealsarlprcdvcqekaafifcvedralfcrdcdepihvpgtlsgnhqrylatgirvgfasaspcdggsdahdsdhhappmgssehhhhhqqpaptvavdtpspqflpqgwavdellqfsdyetgdklqkesspplgfqelewfadidlfhnqapkggaaagrttaevpelfasqaandvayyrpptrtaaaaftaatgfrqskkarvelpddeedylivpdlg