Tfome Clone Information

TFome Information for pUT1189

TFome Name pUT1189
Template EB167101
Genbank Insert ID HQ858722
Protein Name ZmMYB91
Species Maize
TF Family MYB
Gene ID GRMZM2G119693
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B57 UP 3' Primer Name: B57 DN
5' Primer Tm (º C): 62.3 3' Primer Tm (º C):
5' Primer Sequence: CAC CAT GGG ACG GCT CTC CTG 3' Primer Sequence: GAAGTATTCCAAATTGAATTctatg
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGGACGGCTCTCCTGCGGCGGCGTGCAGCCCAAGCTCCGCAAGGGGCTGTGGTCGCCCGAGGAGGACGAGAGGCTGTACGGTCACATCATTCGACACGGCGTCGGCTGCTGGAGCTCTGTCCCTAAGCTCGCAGGGCTGCAGCGCTGCGGCAAGAGCTGCCGCCTGCGGTGGATCAACTACCTCCGCCCCGACCTCAAGCGCGGCGGCTTCTCGCAGCAGGAGGAGGACCTCATCGTCGCGCTCCACGAGATCCTGGGGAACAGGTGGTCGCAGATCGCGTCGCACTTGCCGGGGCGGACGGACAACGAGATCAAGAACCTGTGGAACAGCTGCCTCAAGAAGAAGCTCCGGCAGCGCGGCATCGACCCGGCCACGCACAAGCCGATCGCCGCGGAGGCGGGCTCGGCGCCGCTGCACCGCGACGACCAGAGCAAGCCGCAGCAGCAGCCTGCGGCGGCGGCCGTGTTCGACCCGTTCCCGGTGACCGACTTCGGCTTCGACCTGGGCGCGGCGGCATTGTACGGCGACGACGTCGGCGGCGACGCGTCGTCGGACGCCGGGTTCTTGGCCGACTACAGCAGCGTGCTGGACGTGTCGGAGAACCTGGGCTACGGGGAGAGCTCCAGCAACAGCAGCGGCTGGAACTGCGCGGAGATGGGCAATGCCGTGCTCGACAGCGAGGCGCTGCACTGGACCTCAGCCGCCGCCGCTGCCGCCACCAAGCCGGAGCCCTGCTCGGAGCTGGAGCAGCAGCGCAGCGGAGGATTGAGTTCAGAAGTGTTCAACATAGAATTCAATTTGGAATACTTC
TFome clones do not contain stop codon at 3'end.
translation: MGRLSCGGVQPKLRKGLWSPEEDERLYGHIIRHGVGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGGFSQQEEDLIVALHEILGNRWSQIASHLPGRTDNEIKNLWNSCLKKKLRQRGIDPATHKPIAAEAGSAPLHRDDQSKPQQQPAAAAVFDPFPVTDFGFDLGAAALYGDDVGGDASSDAGFLADYSSVLDVSENLGYGESSSNSSGWNCAEMGNAVLDSEALHWTSAAAAAATKPEPCSELEQQRSGGLSSEVFNIEFNLEYF