Tfome Clone Information

TFome Information for pUT1326

TFome Name pUT1326
Template
Genbank Insert ID HQ858828
Protein Name OsMYB2
Species Rice
TF Family MYB
Gene ID LOC_Os01g04930
transcript
Vector
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 0.0 3' Primer Tm (º C): 0.0
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGATGATGAGGGATGTGTGCATGGAGGTGCTGCCTCCGATGGACCACTACGCGTCGAGGGGGAACTGGTTCATGGCGCGCAAGTGGTCGCCGGAGGAGAACAAGCAGTTCGAGCGGGCGCTCGCCGGGCTGGACCTGCGGTGCCCGGACTGGGACCGGGTGGCGCGCGCCATCCCGGGCAGGTCGGCGCTCGAGGTCATGAACCACTTCAGGGACCTCGAGCTCGACGTCCAGCAGATCGAGAATGGCATGGTGCCCTTCCCGGTCTACGGCGCCGCCGCCGCCGGCGGCGCGTTCACACTGCAGTGGGATGGCGCCCATGGCGTCGGGGACTTCAGGAACGCGTACCGGTTCGGCGGCGGCGGCGGCGGGAAGCGGCACTTCGGCCGTACGCCGGAGCAGGAGAGGAAGAAAGGCGTGCCATGGACGGAGGAGGAGCACAAGTTGTTCCTCTTAGGACTGAAGAAATATGGGAAAGGGGATTGGAGGAACATATCCCGCAATTTCGTGCAGACGAGGACGCCGACGCAGGTTGCCAGCCATGCGCAGAAGTATTTCATCAGGCTCAACTCCGGTGGCAAGGACAAGAGGAGATCCAGCATCCATGACATTACCACGGTTAACCTGACGGATGACCGGCCTCCCTCGCCATCACAGTCCTCCTTGATCAGCAATCAGTCCAACACATCAACTCTGACCGCAGCGGTTGCCCCCTTCTCATCGACGGCCGATGTCAAGCCACAGAATGCCGCGAATGCGTCCTTCAATTCGCCAAGCCGGACACTTGGGATGGCGGGTTACGGGATGGGATTGCAAGATCAAGGATTGCAGTGTGGTGGTCCTCTACATGATCAGTTGGCCGCGAGCCGAAGCATATTGTTT
TFome clones do not contain stop codon at 3'end.
translation: mmmrdvcmevlppmdhyasrgnwfmarkwspeenkqferalagldlrcpdwdrvaraipgrsalevmnhfrdleldvqqiengmvpfpvygaaaaggaftlqwdgahgvgdfrnayrfggggggkrhfgrtpeqerkkgvpwteeehklfllglkkygkgdwrnisrnfvqtrtptqvashaqkyfirlnsggkdkrrssihdittvnltddrppspsqsslisnqsntstltaavapfsstadvkpqnaanasfnspsrtlgmagygmglqdqglqcggplhdqlaasrsilf