Tfome Clone Information

TFome Information for pUT1332

TFome Name pUT1332
Template
Genbank Insert ID HQ858833
Protein Name OsEIL7
Species Rice
TF Family EIL
Gene ID LOC_Os07g48630
transcript
Vector
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 0.0 3' Primer Tm (º C): 0.0
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGATGGGAGCAGCGGTGACCATGGTGGATCGGCGCATGGCGTTCGCGGCGGAGGCCGACGTTGATAGCAAGGCCGCCTTTGGATTCTTCGGAGGCGAGTGCTTCGTCGGCGAGGGCGACCTGGTCAACCCGGCGCCGCCGCCGCCGCAGCAGCAGCAGGTGCACGAGGGCGGATTCGCCGCCGAGGACGAGAGCGACGGCGACGACGACGACGACGACGACGACGACGTGGACGACATCGAGGAGCTGGAGCGCCGCATGTGGCGCGACCGCGTCCGGCACAAGCGGCTCAAGGAGCTTCAGCAGAGCCGCGCCGGGAGGGAGAGCCGGGCGGGCGACGCCGGCGGCGGAGGCAGGCAGCAGCGGCAGTCGCAGGAGCAGGCGCGGCGGAAGAAGATGTCGCGGGCGCAGGACGGGATCCTCAAGTACATGCTCAAGATGATGGAGGTGTGCAACGCGCAGGGGTTCGTGTACGGCATCATCCCGGAGAAGGGGAAGCCGGTGAGCGGCGCCTCCGACAACCTCCGCTCATGGTGGAAGGAGAAGGTCCGCTTCGACCGCAATGGCCCGGCCGCCATCGCCAAGTACCAGGCCGACAACGCCGTGCCGGGGTGCGACGGCGACGCCGGCGGCGCCGCGCCGGCGGGGCCGCACTCCCTGCACGAGCTGCAGGACACCACGCTGGGATCGCTGCTCTCGGCGCTCATGCAGCACTGCGACCCGCCGCAGCGCCGCTTCCCGCTGGAGAAGGGCGTGCCGCCGCCGTGGTGGCCGGAGGGGAGCGAGGCGTGGTGGCCCGAGGCCGGCGTGCCCAAGGAGCTCGGCCCGCCGCCGTACAAGAAGCCGCACGACCTCAAGAAGGCGTGGAAGGTCGCCGTGCTCACCGCCGTCATCAAGCACATGTCCCCCGACGTCGACAAGGTCCGCCGCCTCGTGCGTCAGTCCAAGTGCCTCCAGGACAAGATGACCGCCAAGGAGATCGTCACCTGGCTCGCCGTCCTCAAGCAGGAGGAGGACCTCTATCTCAAGCTCCATCCCGGCGCCCTCCCCCCGCCGCTCTCCGCCGCGTCCTTCAACGCCAGCGTCTCCGGCGAGTACGACGTCGAAGGAGTCGACGGCGACGAGGCCGGGAACAACAACCTGCAGAAGGCGCAGAACGACGCGACCGCGTTCATGGACCTCACCACCACCATGGATGCTGCTCTGAGCAACAACAAGTTCCTGATCATGCCGCTGATGAAGGAAGAGGCCATCGACGTCGACTTCATCCAGAAGAGGAGCGAGCCGGAGCTGATGCTGAGCAGCGACAGCCATGCCCGCGTCTACACCTGCGGCAACGTGCAGTGCCCGCACAGCAACTACGCGCTCGGCTTCCTCGACCGCAACGAACGCAACGCCCATCAGTACGCCTGCAAGCACAACGCCGCCGCCGCCGCCGCCGAGAGCAAGCCGCCGCCGCCGCACATCTTCGAGCCACTCGGCAGCTTCGACTTCGACCTCCCCGTCGACGGCCAGAGATGCCTCGCCGGGCTGATGACCATGTACGACAACGACGTCGCCGCCGCCACGCAGATGCACCACCACCACCATCAGCAGCAGCAGGCTAATTTCTTCATCCGCGACGACGCGCCGTTCGGAGGCGACGTCGCCGCCACGGCGGCGGCGGCGCCGGAGTTCAGGTTCAGTTCAAATTTCAACGTGACAGGAGGGGGCGCCGTGGACTACGGCGGCGCCATGCAGCAACCGCCGGCGAAGTACGCCGGATCCAACTGGTTCTAC
TFome clones do not contain stop codon at 3'end.
translation: mmgaavtmvdrrmafaaeadvdskaafgffggecfvgegdlvnpappppqqqqvheggfaaedesdgdddddddddvddieelerrmwrdrvrhkrlkelqqsragresragdaggggrqqrqsqeqarrkkmsraqdgilkymlkmmevcnaqgfvygiipekgkpvsgasdnlrswwkekvrfdrngpaaiakyqadnavpgcdgdaggaapagphslhelqdttlgsllsalmqhcdppqrrfplekgvpppwwpegseawwpeagvpkelgpppykkphdlkkawkvavltavikhmspdvdkvrrlvrqskclqdkmtakeivtwlavlkqeedlylklhpgalppplsaasfnasvsgeydvegvdgdeagnnnlqkaqndatafmdltttmdaalsnnkflimplmkeeaidvdfiqkrsepelmlssdsharvytcgnvqcphsnyalgfldrnernahqyackhnaaaaaaeskpppphifeplgsfdfdlpvdgqrclaglmtmydndvaaatqmhhhhhqqqqanffirddapfggdvaataaaapefrfssnfnvtgggavdyggamqqppakyagsnwfy