Tfome Clone Information

TFome Information for pUT1546

TFome Name pUT1546
Template
Genbank Insert ID HQ858844
Protein Name OsOrphan49
Species Rice
TF Family Orphans
Gene ID LOC_Os04g45690
transcript
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 0.0 3' Primer Tm (º C): 0.0
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGAAGGTGCAGTGCGACGTGTGCGCGGCCGAGGCCGCCTCGGTCTTCTGCTGCGCCGACGAGGCCGCGCTGTGCGACGCGTGCGACCGCCGCGTCCACAGCGCGAACAAGCTCGCCGGGAAGCACCGCCGATTCTCCCTCCTCCAACCGTTGGCGTCGTCGTCGTCCGCCCAGAAGCCACCGCTCTGCGACATCTGTCAGGAGAAGAGGGGGTTCTTGTTCTGCAAGGAGGACAGGGCGATCCTGTGCCGGGAGTGCGACGTCACGGTGCACACCACGAGCGAGCTGACGAGGCGGCACGGCCGGTTCCTCCTCACCGGCGTGCGCCTCTCGTCGGCGCCGATGGACTCCCCCGCGCCGTCGGAGGAAGAGGAGGAGGAAGCAGGGGAGGACTACAGCTGCAGCCCCAGCAGCGTCGCCGGCACCGCCGCGGGGAGCGCGAGCGACGGGAGCAGCATCTCCGAGTACCTCACCAAGACGCTGCCCGGTTGGCACGTCGAGGACTTCCTCGTCGACGAGGCCACCGCCGCCTCCTCCTCCTCAGACGGGCTATTTCAGGGTGGGCTGCTGGCTCAGATCGGTGGGGTGCCGGACGGTTACGCGGCGTGGGCCGGCCGGGAGCAGCTGCACAGTGGCGTCGCTGTCGCCGCCGACGAGCGGGCCAGCCGCGAGCGGTGGGTGCCGCAGATGAACGCGGAGTGGGGCGCCGGCAGCAAGCGACCCAGGGCGTCGCCTCCCTGCTTGTACTGG
TFome clones do not contain stop codon at 3'end.
translation: MKVQCDVCAAEAASVFCCADEAALCDACDRRVHSANKLAGKHRRFSLLQPLASSSSAQKPPLCDICQEKRGFLFCKEDRAILCRECDVTVHTTSELTRRHGRFLLTGVRLSSAPMDSPAPSEEEEEEAGEDYSCSPSSVAGTAAGSASDGSSISEYLTKTLPGWHVEDFLVDEATAASSSSDGLFQGGLLAQIGGVPDGYAAWAGREQLHSGVAVAADERASRERWVPQMNAEWGAGSKRPRASPPCLYW