Tfome Clone Information

TFome Information for pUT1618

TFome Name pUT1618
Template
Genbank Insert ID HQ858855
Protein Name OsWRKY44
Species Rice
TF Family WRKY
Gene ID LOC_Os04g46060
transcript
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name: R219DN
5' Primer Tm (º C): 53.3 3' Primer Tm (º C): 52.7
5' Primer Sequence: caccatgtatgcgtgcat 3' Primer Sequence: gaaggaggtgaaggcg
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: AuGuAuGCGuGCAuGGAAGGGAGCCAGuuGGAGACGGCuuGCCuCCCuGCCGCGCuCuACGCGCCGCuCuGCCCGuACACGCCGCCuuCCCCuCCuuCCuuuCuuGCGCCAuuGCCGAGCCuGCAGCACAAGCuuCCCCAGCuGCCGCAGCuGGuCCACGACCACGCCGCCGCCACCGGGACGAACCAuGGCGuGAuGuuCuCGuCGGACCAuGGCuGCCuGuACCCGCuGCuCCCGGGGAuCCCGuuCuGCCuCGACuCCGGCuGCGGCGCCGCCGCCuGCGACGACGACAAGCCCGCCGGuuuCGCGCACuuGGGCuCCGCCGAGGCGGACACAuCGGCGGCGGCGGCGAGAGuGGAuAGCGAGAuuGCuGCAGCuGCCACCGCAACCACuuGCCAuGGGCCuAAuuCAuGGuGGAAGGGGACGGAGAAGGGGAAGAuGAAGGuGAGGAGGAAGAuGAGGGAGCCGAGGuuCuGCuuCCAGACCAGGAGCGAuGuGGAuGuGCuGGACGACGGCuACAAGuGGAGGAAGuAuGGCCAGAAGGuuGuCAAGAACAGCCuCCACCCAAGGAGCuACuACAGGuGCACCCACAACAACuGCCGCGuGAAGAAGCGGGuGGAGCGGCuGuCGGAGGAuuGCCGCAuGGuGAuCACCACCuACGAGGGCCGCCACACCCACACCCCCuGCAGCGACGACGCCACCACCGGCGCCGCCGGCGACCACACCGCCAGCuGCGCCuuCACCuCCuuC
TFome clones do not contain stop codon at 3'end.
translation: MYACMEGSQLETACLPAALYAPLCPYTPPSPPSFLAPLPSLQHKLPQLPQLVHDHAAATGTNHGVMFSSDHGCLYPLLPGIPFCLDSGCGAAACDDDKPAGFAHLGSAEADTSAAAARVDSEIAAAATATTCHGPNSWWKGTEKGKMKVRRKMREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHTPCSDDATTGAAGDHTASCAFTSF