Tfome Clone Information

TFome Information for pUT1854

TFome Name pUT1854
Template EB640531
Genbank Insert ID HQ858793
Protein Name ZmMYB31
Species Maize
TF Family MYB
Gene ID GRMZM2G050305
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B1 UP 3' Primer Name: B1 DN
5' Primer Tm (º C): 67.2 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGTCGCCGTGC 3' Primer Sequence: TTTCATCTCGAGGCTTCT
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGGGAGGTCGCCGTGCTGCGAGAAGGCGCACACCAACAAGGGCGCGTGGACCAAGGAGGAGGACGAGCGCCTGGTCGCGCACATCAGGGCGCACGGCGAGGGGTGCTGGCGCTCGCTGCCCAAGGCCGCCGGCCTCCTGCGCTGCGGCAAGAGCTGCCGCCTCCGCTGGATCAACTACCTCCGCCCCGACCTCAAGCGCGGCAACTTCACGGAGGAGGAGGACGAGCTCATCGTCAAGCTGCACAGCGTCCTCGGCAACAAGTGGTCCCTGATCGCCGGAAGGCTGCCCGGCAGGACGGACAACGAGATCAAGAACTACTGGAACACGCACATCCGGAGGAAGCTGCTGAGCAGGGGGATCGACCCGGTGACGCACCGCCCGGTCACGGAGCACCACGCGTCCAACATCACCATATCGTTCGAGACGGAGGTGGCCGCCGCTGCCCGTGATGATAAGAAGGGCGCCGTCTTCCGGCTGGAGGAGGAGGAGGAGCGCAACAAGGCGACGATGGTCGTCGGCCGCGACCGGCAGAGCCAGAGCCAGAGCCACAGCCACCCCGCCGGCGAGTGGGGCCAGGGGAAGAGGCCGCTCAAGTGCCCCGACCTCAACCTGGACCTCTGCATCAGCCCGCCGTGCCAGGAGGAGGAGGAGATGGAGGAGGCTGCGATGAGAGTGAGACCGGCGGTGAAGCGGGAGGCCGGGCTCTGCTTCGGCTGCAGCCTGGGGCTCCCCAGGACCGCGGACTGCAAGTGCAGCAGCAGCAGCTTCCTCGGGCTCAGGACCGCCATGCTCGACTTCAGAAGCCTCGAGATGAAA
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEKAHTNKGAWTKEEDERLVAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIVKLHSVLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRGIDPVTHRPVTEHHASNITISFETEVAAAARDDKKGAVFRLEEEEERNKATMVVGRDRQSQSQSHSHPAGEWGQGKRPLKCPDLNLDLCISPPCQEEEEMEEAAMRVRPAVKREAGLCFGCSLGLPRTADCKCSSSSFLGLRTAMLDFRSLEMK