Tfome Clone Information

TFome Information for pUT1886

TFome Name pUT1886
Template DR793321
Genbank Insert ID HQ858799
Protein Name ZmMYB44
Species Maize
TF Family MYB
Gene ID GRMZM2G111731
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B37 UP 3' Primer Name: B37 DN
5' Primer Tm (º C): 64.7 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCCGCCTTCTTCGCT 3' Primer Sequence: TGC CGC GCC GAC GCC GAG GAA G
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGCCGCCTTCTTCGCTGCTGCTCCGCCGCCGGCGGCGGGTGCTCTCGCGTCGTTCCACCACGAGGAGCAGCAGCGTCAGGACGCCGCCGAGGAGCTGTACCACGTGGACGACGACGTCGGCGAGGGCGGCTGCGGCGCAGGACAGCAGGGGAAGCTGTGCGCCAGGGGCCACTGGCGCCCCGCCGAGGACGCCAAGCTCAAGGAGCTCGTCGCGCAGTACGGGCCCCAGAACTGGAACCTCATCGCCGAGAGGCTGGACGGCAGATCAGGGAAGAGCTGCCGCCTGCGGTGGTTCAACCAGCTGGACCCGCGGATCAACCGCCGGGCCTTCTCCGGCGAGGAGGAGGAGCGGCTGCTGGCGGCGCACCGCGCGTACGGCAACAAGTGGGCGCTCATCGCGCGCCTCTTCCCCGGCCGCACCGACAACGCCGTCAAGAACCACTGGCACGTCCTCATGGCGCGCAAGCAGCGGGAGCACACCGGCGCGCTCCGCCGGCGCAAACCCTCGTCCTCGCCGGACCCGGCGCCGCCGACGTCGCACTTGGCGCCCGTCGTCGTCCTCCACCACCACCACCACCAGCACCACGCCGGCTCGCCTCCGCGCACCGTCGCCGCCGCTCACGCGCAGTACACGGCAGCGGACACCCGCGCGCACAGCGGCGGCGAGTCCGACGAGACCGCGTCCACCTGCACCACCGACCTGTCCCTCGGCTCCGCCGCCGCCCCCTGCTTCTACCAGAGTGGCTACGACGCGGCTCCGCGCGCCGCGGCGTTCGCGCCCAGCGCGCGCTCCGCCTTCTCCGCGCCGCCGGCGTCGGCGCGCCATGGCGAGTCACGCTCCGACGACAAGGCGTCGCCGCCCTTCTTCGACTTCCTCGGCGTCGGCGCGGCA
TFome clones do not contain stop codon at 3'end.
translation: MAAFFAAAPPPAAGALASFHHEEQQRQDAAEELYHVDDDVGEGGCGAGQQGKLCARGHWRPAEDAKLKELVAQYGPQNWNLIAERLDGRSGKSCRLRWFNQLDPRINRRAFSGEEEERLLAAHRAYGNKWALIARLFPGRTDNAVKNHWHVLMARKQREHTGALRRRKPSSSPDPAPPTSHLAPVVVLHHHHHQHHAGSPPRTVAAAHAQYTAADTRAHSGGESDETASTCTTDLSLGSAAAPCFYQSGYDAAPRAAAFAPSARSAFSAPPASARHGESRSDDKASPPFFDFLGVGAA