Tfome Clone Information

TFome Information for pUT2285

TFome Name pUT2285
Template BT054758.1
Genbank Insert ID KJ726796
Protein Name ZmMYB64
Species Maize
TF Family MYB
Gene ID GRMZM2G124715
transcript T03
Vector pENTR/SD/D-TOPO
Note c.A95G p.H32R in functional domain, not in FlcDNA
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGGAGGTCCCCGTGCTGCGAGCAGGCGCACACCAACAAGGGCGCGTGGACCAAGGAGGAGGACCAGCGCCTCATCGCCTACATCAAGGCCCGCGGCGAGGGCTGCTGGAGGTCGCTACCAAAAGCCGCAGGGCTGCTGCGGTGCGGGAAGAGCTGCCGGCTGCGGTGGATCAACTACCTGCGCCCGGACCTCAAGCGCGGCAACTTCAGCGAGGAGGAGGACGAGCTGATCATCAAGTTCCACGAGCTGTTCGGCAACAAGTGGTCGCTCATCGCCGGGAGGCTGCCGGGCAGGACGGACAACGAGATAAAAAACTACTGGAACACGCACATCAAGCGGAAGCTGCTCGCCCGCGGCATGGACCCGCAGACCCACCGCCCGCTGGCCGCAGCGCCAGCAGGAGGGCCGCAGCAGCAGCATTGCCATTACCAGATGGAGCCACAGAAGCGGGCGGCGGCGGCGGACCATTCCGAGGCCGCCGTTGCCACCAACTCGCCGGAGGCCAGCAGCCGCAGCAGCGACGACGACGAGGCGCCGGCGCTGGCGCCACCGCCGCGGCGGCGGCAGCGCCACCTCGACATCGACCTGAACCTGTCCATCAGCCTCGCGGCCTACCAGCCGCCGGAGGGAACCGGCAGCGCCATCGAGCCACTGACGGCGACGACGAAGCGGGAGGAGGGAACGGCGGCGGCGGTGTGCCTCTGCCTCAACAGCCTCGGGTACCGGGCAGGCGTCGAGTGCGCCTGTGGCAGCGGCGGCTCGCCGTCGTCCCGTTCGCAGTGGGCTCGGGATTTTTTACAGGCGGCGCCCTGCTACAGAGGC
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEQAHTNKGAWTKEEDQRLIAYIKARGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFSEEEDELIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARGMDPQTHRPLAAAPAGGPQQQHCHYQMEPQKRAAAADHSEAAVATNSPEASSRSSDDDEAPALAPPPRRRQRHLDIDLNLSISLAAYQPPEGTGSAIEPLTATTKREEGTAAAVCLCLNSLGYRAGVECACGSGGSPSSRSQWARDFLQAAPCYRG