Tfome Clone Information

TFome Information for pUT3029

TFome Name pUT3029
Template BT069656
Genbank Insert ID KJ726802
Protein Name ZmMYB67
Species Maize
TF Family MYB
Gene ID GRMZM2G089244
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGGAGGTCCCCGTGCTGCGAGCAGGCGCACACCAACAAGGGCGCGTGGACCAAGGAGGAGGACCAGCGCCTCGTCGCCTACATCAAGGCCCACGGCGAGGGCTGCTGGAGATCGCTACCAAAAGCCGCAGGTCTGCTGCGCTGCGGGAAGAGCTGCCGGCTGCGGTGGATCAACTACCTGCGCCCGGACCTCAAGCGCGGCAACTTCACCGAGGAGGAGGATGACCTCATCATCAAGTTCCACGAGCTCTTCGGCAACAAGTGGTCGCTCATCGCCGGGAGGCTGCCGGGCAGGACGGACAACGAGATCAAGAACTACTGGAACACGCACATCAAGCGCAAGCTCCTCGCCCGCGGCATGGACCCGCAGACGCACCGCCCGCTCGCCAGCGCGACCGCGGGGCAGCAGCATTACCAGCTGCAGGAGCCGCAGAAGCGAGCGGCCGGCGGCGGTCCAGCAGGCCATCCGCACCAGGACCACTTGGAGGTCGTCGTCATCTCGAACTCGCCGGACGAGGCCTACAGCCGTAGCAGCGACGACGAGCCGCGGTCCGCCACGCCGCCGCGGCGCCACCTCGACATCGACCTCAACCTGTCCATCAGCCTAGCGGCCTACCAGCCGCCGGAGGAAACCGGCATCATCAAGCAGCCACTGGTGATGAAGCAGGAGCAGGAAACGGCGGCGGGCGGCACCAATGCCGCGGCGGTGTGCCTGTGCCTCAACAGCCTCGGGTACCGGCCGGGCGTCGAGTGCGTCTGCGGCGACGGCAGCTCCTCCTCCTCCTCCTCGCACTCCCACTCCCACTCCCACCAATGGGCTCTGAATTTTTTACAGGCGGCGGCGCCCTGCTACAGAGGCCAA
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEQAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDDLIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARGMDPQTHRPLASATAGQQHYQLQEPQKRAAGGGPAGHPHQDHLEVVVISNSPDEAYSRSSDDEPRSATPPRRHLDIDLNLSISLAAYQPPEETGIIKQPLVMKQEQETAAGGTNAAAVCLCLNSLGYRPGVECVCGDGSSSSSSSHSHSHSHQWALNFLQAAAPCYRGQ