TFome pUT3148
Template BT034634.1
Genbank Insert ID JX469906
Protein Name ZmMYB110
Species Zea mays
TF Family MYB
Gene id GRMZM2G176327
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information Deposited to ABRC
Subgenome: 2

TFome pUT3148

Placeholder text:
"TFome" is used as a synonym for "clone".
"TFome" is short for "transcription factor open reading frame".

5' Primer

Name B279_F
Temperature (ºC) 68.0
Sequence
Copy to clipboard
caccATGGCGGCGCGTGACCAC

3' Primer

Name B279_R
Temperature (ºC)
Sequence
Copy to clipboard
CAGCCCCATTATCTGCGTGTACCAC

PCR Condition

30 sec 98°C, 35x(10sec 98°C, 30sec 58°

Amino Acid Sequence
Copy to clipboard

MAARDHRELSGDEDSVVAAGDLRRGPWTVEEDMLLVNYVAAHGEGRWNALARCAGTRCCMLVATLRDDDQTNNTMNCAYAGLRRTGKSCRLRWLNYLRPDLRRGNITAQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARQLNCDVNSQRFKDLMRYIWMPRLLERIGSDDSGDGAFVIDAATPTPTPTLLTAATWCVDDVELSCTTAVSSSSSVSTDSMHQQQQQQQLVAVSPPPQPAAFGESNNDASHYGVHNSNAAMSMWGDTLCQPPHSATPHLAGAGTCSWSDESLLVPDAGGGVYADMGLPDLCDTDTMWAAGASADDDLWYTQIMGL

TFome clones do not contain stop codon at 3'end.

CDS
Copy to clipboard

ATGGCGGCGCGTGACCACCGAGAGCTGAGCGGCGACGAGGACTCCGTGGTGGCGGCCGGAGACCTCCGCCGCGGGCCATGGACGGTGGAGGAGGACATGCTCCTCGTCAACTACGTCGCCGCGCACGGCGAGGGCCGCTGGAACGCGCTGGCACGATGCGCAGGTACGCGGTGCTGCATGCTGGTTGCCACGCTACGAGACGACGACCAGACTAATAACACAATGAACTGCGCATATGCAGGGCTCCGGCGGACGGGGAAGAGCTGCCGCCTGCGGTGGCTCAACTACCTGCGGCCGGACCTGCGGCGGGGCAACATCACGGCGCAGGAGCAGCTGCTCATCCTGGAGCTGCACTCCCGCTGGGGCAACCGCTGGTCCAAGATCGCGCAGCACCTCCCGGGGCGCACCGACAACGAGATCAAGAACTACTGGCGCACGCGGGTGCAGAAGCACGCCAGGCAGCTCAACTGCGACGTCAACAGCCAGCGCTTCAAGGACCTCATGCGCTACATCTGGATGCCGCGCCTCCTCGAGCGCATCGGCTCCGACGACTCCGGGGACGGCGCCTTCGTTATCGACGCCGCCACGCCGACGCCAACGCCGACGCTCCTCACGGCCGCCACGTGGTGCGTGGACGACGTCGAGCTGTCCTGCACCACCGCCGTGTCGTCGTCGTCGTCCGTGTCCACGGACAGCATGCACCAGCAGCAGCAGCAGCAGCAGCTCGTCGCCGTGTCCCCGCCGCCACAGCCCGCCGCCTTTGGCGAGAGCAACAACGACGCCTCCCACTACGGTGTCCACAACAGCAACGCTGCTATGTCCATGTGGGGGGACACGCTGTGCCAACCACCGCACTCGGCGACGCCGCACCTGGCGGGCGCCGGGACCTGCAGCTGGTCAGACGAGTCTCTGCTGGTACCTGATGCCGGCGGCGGCGTGTACGCCGACATGGGGCTTCCGGACCTCTGCGACACCGACACCATGTGGGCCGCCGGCGCCAGCGCCGACGACGACCTGTGGTACACGCAGATAATGGGGCTG


Copyright © 2023 Grassius.org | Last updated: 2023-06-26