Tfome Clone Information

TFome Information for pUT3148

TFome Name pUT3148
Template BT034634.1
Genbank Insert ID JX469906
Protein Name ZmMYB110
Species Maize
TF Family MYB
Gene ID GRMZM2G176327
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B279_F 3' Primer Name: B279_R
5' Primer Tm (º C): 68.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCGGCGCGTGACCAC 3' Primer Sequence: CAGCCCCATTATCTGCGTGTACCAC
PCR Condition: 30 sec 98°C, 35x(10sec 98°C, 30sec 58°
Nucleotide Sequence: ATGGCGGCGCGTGACCACCGAGAGCTGAGCGGCGACGAGGACTCCGTGGTGGCGGCCGGAGACCTCCGCCGCGGGCCATGGACGGTGGAGGAGGACATGCTCCTCGTCAACTACGTCGCCGCGCACGGCGAGGGCCGCTGGAACGCGCTGGCACGATGCGCAGGTACGCGGTGCTGCATGCTGGTTGCCACGCTACGAGACGACGACCAGACTAATAACACAATGAACTGCGCATATGCAGGGCTCCGGCGGACGGGGAAGAGCTGCCGCCTGCGGTGGCTCAACTACCTGCGGCCGGACCTGCGGCGGGGCAACATCACGGCGCAGGAGCAGCTGCTCATCCTGGAGCTGCACTCCCGCTGGGGCAACCGCTGGTCCAAGATCGCGCAGCACCTCCCGGGGCGCACCGACAACGAGATCAAGAACTACTGGCGCACGCGGGTGCAGAAGCACGCCAGGCAGCTCAACTGCGACGTCAACAGCCAGCGCTTCAAGGACCTCATGCGCTACATCTGGATGCCGCGCCTCCTCGAGCGCATCGGCTCCGACGACTCCGGGGACGGCGCCTTCGTTATCGACGCCGCCACGCCGACGCCAACGCCGACGCTCCTCACGGCCGCCACGTGGTGCGTGGACGACGTCGAGCTGTCCTGCACCACCGCCGTGTCGTCGTCGTCGTCCGTGTCCACGGACAGCATGCACCAGCAGCAGCAGCAGCAGCAGCTCGTCGCCGTGTCCCCGCCGCCACAGCCCGCCGCCTTTGGCGAGAGCAACAACGACGCCTCCCACTACGGTGTCCACAACAGCAACGCTGCTATGTCCATGTGGGGGGACACGCTGTGCCAACCACCGCACTCGGCGACGCCGCACCTGGCGGGCGCCGGGACCTGCAGCTGGTCAGACGAGTCTCTGCTGGTACCTGATGCCGGCGGCGGCGTGTACGCCGACATGGGGCTTCCGGACCTCTGCGACACCGACACCATGTGGGCCGCCGGCGCCAGCGCCGACGACGACCTGTGGTACACGCAGATAATGGGGCTG
TFome clones do not contain stop codon at 3'end.
translation: MAARDHRELSGDEDSVVAAGDLRRGPWTVEEDMLLVNYVAAHGEGRWNALARCAGTRCCMLVATLRDDDQTNNTMNCAYAGLRRTGKSCRLRWLNYLRPDLRRGNITAQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARQLNCDVNSQRFKDLMRYIWMPRLLERIGSDDSGDGAFVIDAATPTPTPTLLTAATWCVDDVELSCTTAVSSSSSVSTDSMHQQQQQQQLVAVSPPPQPAAFGESNNDASHYGVHNSNAAMSMWGDTLCQPPHSATPHLAGAGTCSWSDESLLVPDAGGGVYADMGLPDLCDTDTMWAAGASADDDLWYTQIMGL