Tfome Clone Information

TFome Information for pUT3152

TFome Name pUT3152
Template BT035959.1
Genbank Insert ID JX469908
Protein Name ZmMYB73
Species Maize
TF Family MYB
Gene ID GRMZM2G121570
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B292_F 3' Primer Name: B292_R
5' Primer Tm (º C): 66.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGTCCAGCGCCCTGCG 3' Primer Sequence: ACGGAACCTGGCCAGGTC
PCR Condition: 40 sec 98°C, 35x(10sec 98°C, 30sec 58°
Nucleotide Sequence: ATGTCCAGCGCCCTGCGCGCCGCCTGGAGCGGGGCTCAGCAGCAGCTGCCGCCCCACGCGGGCGGTGGCATCGGCGGGCATAGGGCGCAGCACCACAAGGGCCCCTGGACCGAGGCGGAGGACGTAGTCCTCAGGGAGATGGTGATGAAGCACGGCGACCGGAAGTGGGCGGTGATAGCGCAGTCGCTCCCCGGCAGGGTGGGCAAGCAGTGCCGCGAGAGATGGACCAACCACCTGCGCCCCGACCTCAAGAAGAGCGTGTGGACTGAAGAAGACGACATGGCGCTGATCAAGGCGCACAAGCGGTGCGGCAACCACTGGTCGACCATCGCCACGTTCCTGCCCGGGCGTTCCGAGAACGCCGTGAAGAACCACTGGAACGCCACCAAGCGGAGCCTCAAGGCCAAGCGCCGGCTGAAGAAGAAGAGCAACGCGCAGCAGGTGCCGGCCGGGCAGTGGTCCGTCCTGGAGGAGTACATCCGCAGCCTGTACCCTGACCTCGCCGACGGCGCCGGCGCCGACCAGACCCCGCCGGCGGCCGAGGACTCCCCCCCGTCGTCCTACAACCTCGGGTCGTACTCGTACGGCGAGGTGATCAGCAGCCCAGCGTCCGCCGCCGCGCCGCCCGGCAGCTTTGACCAGATGACCGCCATGGGGCTGTACCTGGGCGCGTCGTCGTCGTCGCCCGCGCCGGCCGAGCTGCAGGGGGGCATGAGCTCCGACATCGTGGCGCCGTTCCTGCACCTGGACCTCAACGCCTACTACGGCGGCGCGCCGGCGGCGACGATGCGGCTTATGGCTCCGATGGGGGGAATGGCGGCGCCTGTGCCGCAGATGATGGAGCACGATCACTACCAGCACCAGCAGGCTTCCTACGCCACCGCCAACCAGCTGCTCACGTACCCCTTCATCGACAACAGCGTCATGTGGCAGCAGGCGCCGTACGCCGCCCATGGCAGCGCCGCCTACGGCGGTGGCGCCGACGCGGCAGGTGCCGGCCCGAGCAACGTCGTCGCCGTTCCGGCGGACGACGTCGACGTCGTCCAGATGGCCTCCAGGGAGTTCCTGACGCCGTCGGAGGACGAGGTCACCCTGGACCTGGCCAGGTTCCGT
TFome clones do not contain stop codon at 3'end.
translation: MSSALRAAWSGAQQQLPPHAGGGIGGHRAQHHKGPWTEAEDVVLREMVMKHGDRKWAVIAQSLPGRVGKQCRERWTNHLRPDLKKSVWTEEDDMALIKAHKRCGNHWSTIATFLPGRSENAVKNHWNATKRSLKAKRRLKKKSNAQQVPAGQWSVLEEYIRSLYPDLADGAGADQTPPAAEDSPPSSYNLGSYSYGEVISSPASAAAPPGSFDQMTAMGLYLGASSSSPAPAELQGGMSSDIVAPFLHLDLNAYYGGAPAATMRLMAPMGGMAAPVPQMMEHDHYQHQQASYATANQLLTYPFIDNSVMWQQAPYAAHGSAAYGGGADAAGAGPSNVVAVPADDVDVVQMASREFLTPSEDEVTLDLARFR