Tfome Clone Information

TFome Information for pUT3155

TFome Name pUT3155
Template BT062722.1
Genbank Insert ID JX469910
Protein Name ZmMYB81
Species Maize
TF Family MYB
Gene ID GRMZM2G020772
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B311_F 3' Primer Name: B311_R
5' Primer Tm (º C): 69.1 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGCGGGAGACGTACATGG 3' Primer Sequence: AAACAGAACGCTGTGGTGGCTG
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGATGCGGGAGACGTACATGGACGTGCTGCCGCCGGTGGACCACATAGCCGCCTCACGGAGCGGCGGCTGGTTCCCGGGCGCGGCGCGTCTCTGGACGGCGGCGGAGAACAAGCAGTTCGAGCGGGCGCTGGCCGGGCTCGACCTCTGCCGCCCGGACTGGGAGAAGGTGGCGCGGGCCATCCCGGGCCGGACGGTGCGCGAGGTCGTCAGCCACTTCAAGAGCCTCCAGGTCGACGTCCAGCAGATCGAGAGCGGCCTGGTGCCCATGCCGGTCTACGGCGCCGGGGCCGGCTCGTTCACCCTGCAGTGGGACGGCTGCTACGGCCCCGCGGACTCGAGGCACAACGGCTACCGCTTCGGAAGCGGAGGCTGCGGGAGGCGGCACCACGGCCGCACCCCGGAGCAGGACCGGAAGAAGGGCGTGCCGTGGACGGAGGAGGAGCACAGGCTGTTCCTCTTAGGCCTGAAGAAATACGGCAAGGGGGACTGGAGGAACATATCGCGCAACTACGTCCAGACGCGGACGCCCACGCAGGTGGCCAGCCACGCGCAGAAGTACTTCATCAGGCTCAACTCCGGCGGCAAGGACAAGAGGAGGTCCAGCATCCACGACATCACCACGGTGAACCTGACGGACGACGAGCGGGCGCCCTCGCCGTCGCGGTCCTCTCTGATCACCACCACCAGCCAGCCAAACGCGCCGGCTCCGGCCGCAGCGGTGATAGGCGGGCCCTTCTCGTCGGCGGCGGCGGCCGAGGCCAAGCAGCACCAGCACGGCGCTGGGAACCTGCCACCGAACCGGACCTCCGTGGTGCCGGCTGTTTACAGGATGGACGATTCGCAGGACCACGGCCTGCAGTGTGGCCCTCTGCGTCATCAACTGGTCGCCAGCCACCACAGCGTTCTGTTT
TFome clones do not contain stop codon at 3'end.
translation: MMRETYMDVLPPVDHIAASRSGGWFPGAARLWTAAENKQFERALAGLDLCRPDWEKVARAIPGRTVREVVSHFKSLQVDVQQIESGLVPMPVYGAGAGSFTLQWDGCYGPADSRHNGYRFGSGGCGRRHHGRTPEQDRKKGVPWTEEEHRLFLLGLKKYGKGDWRNISRNYVQTRTPTQVASHAQKYFIRLNSGGKDKRRSSIHDITTVNLTDDERAPSPSRSSLITTTSQPNAPAPAAAVIGGPFSSAAAAEAKQHQHGAGNLPPNRTSVVPAVYRMDDSQDHGLQCGPLRHQLVASHHSVLF