Tfome Clone Information

TFome Information for pUT3205

TFome Name pUT3205
Template BT067757.1
Genbank Insert ID JX469944
Protein Name ZmMYB115
Species Maize
TF Family MYB
Gene ID GRMZM2G423833
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C153_F 3' Primer Name: C153_R
5' Primer Tm (º C): 67.9 3' Primer Tm (º C):
5' Primer Sequence: caccATGACCCAGCTGCCTTCA 3' Primer Sequence: AAACATTTGTCTCTCAATCCATG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGACCCAGCTGCCTTCAAAGTTCAAAAACAAAATGATGGTGGTGAGGGTGGACGAGAACCCTGCGCCGGATGGAGAGAACTCTCCCCTGGACGATGAGTACGTCTCGGCCGACGATGAGCACGTTGACAATGAAGACAAGGAGACCGATAGCATCGGCGACTACGAAAACCCCAGTGGGGCGCCCCAGTTGAAGAAGGGTCCTTGGTCGCCCGAAGAGGATAAGCGTCTTAAAGACTACGTCGAGGTACACGGCGCGGGGAACTGGAATAAGGTGCAGAAGAATGCCATGCTCAACCGTTGTGGCAAGAGCTGCCGTCTCCGCTGGACCAACCACCTCAGGCCCGATCTTAAGAAGGATCCTTTCGACGCTGAGGAAGAGGAAAAGATAATCAAGCTTTACATCAGGTGGGGCCCCAAGTGGTCCATGATGGCCTCATATTTGCCTGGCCGCACAGATAATGAAATAAAAAACTTTTGGAATACCAGAAAAAGGAGAAAACAGAGATGTGGTTCGCCTCTCCATCCAGAATATATGCTTTCTCAGCTTAGTCATAAAGACATGGACTGTGAAACTCCTGGAGAATCACATGGCAAGAAACGGTCAAATGAGTGCTCAAAAGAAAAGGTTGTTGATGTGCAAGAACTTGTGGATGAGTTAATTGTATTTGAGCACCTTGACTATGGTAAGGATACAGTGTTTCCAACCAGACCTTTGAAATGCCATGCATCTACTAGTAGTGTGCAAATTCCTGGTGCCATTGAGAAAACCTTTTGTCCCACTGATTTGAACTATGTAATGACAAAGAATCAGTCGGTGCATGTTGGTAGTGCCATTGGCAGTGGCTATCCAGTATATGGTGGCAGACTCTCTACTTCAGGGACCATATTCGGTTCCATTCAGACAGAGATCCCTTCGATCCAAAGTTCCAGCTATAGCCCAAGTAATGACTGGTTGGCTCAATGTCCTTCGGCTTGCATTGAGCAACGGATTCCAATGGAATGCAATACAATATCTCAGTCAAAAGCTTACCTTATGATGCATTCTTCTTCAGCTTTCTGTGCCCCTGAACATGAGGCCTGTTCTGAAACTCAAGCTCCAGACTTATGTTCAGGTTCAGATGCTGTTTTCGACCCCAGCCAGTGTTATCCAGTTGCTAGTTTTTCTGATCTTGGGATCTCGGATACACTACTAACAAAAGGTCTCTTGAATGATATAGCACTAGCAAGTTTGTTGAATGTTAATTTGAAGGACCAGTCACATATCAACAGGCAGGAACCTACCAATGATACATCACTAGGAGGAGCAAGTTTCTTGAATGCTAATTTGAAGGACCAGTCACATCTCAACTGGCAGGAACATATGAATGAGACATCACCAGTAGCAGGTTTATTGAATGCTAATTTGGAGGAGCAGTCACATCTCAACTGGCAGGAACCTAAGAATGAGTCATCACCAGAAGCAGGTTTCTTGAATGCTAATTTGGAGGAGCAGTCACATCTCAACTGGCCCTTGCAGGAATGTGAGCCATGGATTGAGAGACAAATGTTT
TFome clones do not contain stop codon at 3'end.
translation: MTQLPSKFKNKMMVVRVDENPAPDGENSPLDDEYVSADDEHVDNEDKETDSIGDYENPSGAPQLKKGPWSPEEDKRLKDYVEVHGAGNWNKVQKNAMLNRCGKSCRLRWTNHLRPDLKKDPFDAEEEEKIIKLYIRWGPKWSMMASYLPGRTDNEIKNFWNTRKRRKQRCGSPLHPEYMLSQLSHKDMDCETPGESHGKKRSNECSKEKVVDVQELVDELIVFEHLDYGKDTVFPTRPLKCHASTSSVQIPGAIEKTFCPTDLNYVMTKNQSVHVGSAIGSGYPVYGGRLSTSGTIFGSIQTEIPSIQSSSYSPSNDWLAQCPSACIEQRIPMECNTISQSKAYLMMHSSSAFCAPEHEACSETQAPDLCSGSDAVFDPSQCYPVASFSDLGISDTLLTKGLLNDIALASLLNVNLKDQSHINRQEPTNDTSLGGASFLNANLKDQSHLNWQEHMNETSPVAGLLNANLEEQSHLNWQEPKNESSPEAGFLNANLEEQSHLNWPLQECEPWIERQMF